Recombinant Saccharomyces cerevisiae Protein COS4 (COS4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
COS4; YFL062W; Protein COS4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-379
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COS4
Target Protein Sequence
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFRIWMLLWLPLS VWWKLSNNWIYPLMVSLLVLFWGPVFVLVIFRLSRKRSLSKQLTQFCKEITKSTPSSDPH DWEVVAANLNSYLYENKAWNIRYFFFNAMGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSV PYIEEALGVYFREVEKQWKLFNSEKSWSPVGLEDAKLPKEAYRFKLTWFLKRISNIFMLI PFLNFLCCIYVSRGMCLLLRTLYLGWILFMLVQGFQNIRVLIMSMEHKMQFLSTIINEQE SGANGWDEIARKMNRYLFEKKVWKNEEFFFDGIDCEWFFSHFFYRVLSAKKSMRALSLNV ELWPYIKEAQLSCSEESLA
Uniprot No.

Target Background

Database Links

KEGG: sce:YFL062W

STRING: 4932.YFL062W

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the COS4 protein in Saccharomyces cerevisiae?

COS4 is a protein encoded by the COS4 gene (Entrez Gene ID: 850482) in Saccharomyces cerevisiae S288C strain. It belongs to a family that includes several COS proteins (COS1-COS12) in baker's yeast. The protein is identified by the reference sequence NP_116593.1, corresponding to the mRNA sequence NM_001179905.1 . The COS4 gene was originally identified during the pioneering genome sequencing projects of S. cerevisiae, including the landmark work "Life with 6000 genes" by Goffeau et al. and chromosome VI sequencing by Murakami et al .

What expression systems are recommended for producing recombinant COS4?

S. cerevisiae itself serves as an excellent expression system for producing recombinant COS4 protein due to several advantages:

  • Rapid growth with straightforward and inexpensive culture methods

  • Availability of sophisticated genetic manipulation techniques

  • Wide variety of vectors (episomal, integrative, and copy number controlled)

  • Multiple promoter options (constitutive and inducible)

  • Advanced eukaryotic cellular features including post-translational modifications

  • Ability to generate proteins with human-like glycosylation patterns

  • Protein secretion capabilities that facilitate purification

  • Established fermentation and downstream processing systems

For optimal expression, researchers should consider using specialized S. cerevisiae strains engineered for enhanced protein production and appropriate human-like modifications.

How does the COS gene family relate to COS4 function?

The COS gene family in S. cerevisiae includes multiple members with potential functional relationships. The table below outlines key COS family members identified in the baker's yeast genome:

Gene SymbolProtein AccessionOrganism
COS1NP_014063.1Saccharomyces cerevisiae
COS2NP_009861.1Saccharomyces cerevisiae
COS3NP_013574.1Saccharomyces cerevisiae
COS4NP_116593.1Saccharomyces cerevisiae
COS5NP_012695.3Saccharomyces cerevisiae
COS7NP_010033.1Saccharomyces cerevisiae
COS8NP_011815.1Saccharomyces cerevisiae
COS10NP_014473.1Saccharomyces cerevisiae
COS12NP_011251.1Saccharomyces cerevisiae

Understanding the relationships between these family members can provide insights into potential functional redundancy or specialization of COS4 .

What experimental design considerations are critical when studying COS4 function?

Robust experimental design for COS4 functional studies should include the following methodological components:

  • Variable definition and control:

    • Independent variables: COS4 expression levels, mutations, environmental conditions

    • Dependent variables: Growth rates, cellular phenotypes, biochemical activities

    • Extraneous variables: Genetic background, media composition, culture conditions

  • Hypothesis formulation:

    • Null hypothesis (H0): "COS4 has no effect on the process of interest"

    • Alternative hypothesis (H1): "COS4 impacts the process in a specific manner"

  • Experimental treatments:

    • Systematic manipulation of independent variables

    • Determination of appropriate treatment levels (e.g., expression intensities)

    • Control of variables to avoid confounding effects

  • Measurement approach:

    • Quantitative assessment of dependent variables

    • Multiple measurement timepoints

    • Technical and biological replicates

When implementing experimental designs for COS4 research, researchers should particularly focus on isolating its specific effects from other COS family members, potentially through selective gene deletion or mutation studies.

What vectors and promoters optimize recombinant COS4 expression?

For optimal expression of recombinant COS4, researchers should carefully select from the following options:

Vector types:

  • Episomal vectors (2μ-based): Provide high copy numbers but potential instability

  • Integrative vectors: Allow stable, defined copy number expression

  • Centromeric vectors: Maintain single-copy expression for more physiological levels

Promoter options:

  • Constitutive promoters: GPD, ADH1, TEF for continuous expression

  • Inducible promoters: GAL1/10 (galactose-inducible), CUP1 (copper-inducible), MET25 (methionine-repressible)

S. cerevisiae offers a wide range of auxotrophic strains that can be rescued through transformation with vectors bearing wild-type copies of mutated genes, providing flexible options for selection and maintenance of expression constructs . Expression systems yielding over 1 g/L of recombinant protein have been established for several products in yeast, suggesting potential for high-yield COS4 production under optimized conditions .

How can researchers validate recombinant COS4 structure and function?

A comprehensive validation strategy should employ multiple complementary approaches:

Structural validation:

  • SDS-PAGE and Western blotting with specific antibodies or tag detection

  • Mass spectrometry for sequence verification and post-translational modification analysis

  • Circular dichroism spectroscopy to assess secondary structure

  • Size-exclusion chromatography to determine oligomeric state

Functional validation:

  • Complementation assays in COS4-deficient strains

  • Protein-protein interaction studies with known or predicted partners

  • Subcellular localization studies

  • Activity assays based on predicted molecular function

Design validation experiments with appropriate controls, including COS4 knockout strains complemented with wildtype or mutant variants to establish structure-function relationships.

What purification strategies are most effective for recombinant COS4?

A multi-step purification approach tailored to COS4's properties would typically include:

  • Initial capture:

    • Affinity chromatography using fusion tags (His-tag, GST, FLAG)

    • Ion exchange chromatography based on COS4's predicted isoelectric point

  • Intermediate purification:

    • Size exclusion chromatography to separate monomeric from aggregated forms

    • Hydrophobic interaction chromatography

  • Polishing:

    • High-resolution ion exchange

    • Reverse-phase chromatography for highest purity

S. cerevisiae expression systems offer the advantage of potential secretion of recombinant proteins into the culture media, which greatly facilitates subsequent purification steps . This approach minimizes cellular contaminants and eliminates the need for cell disruption, which can be especially beneficial for maintaining the native structure of COS4.

How can researchers address potential glycosylation heterogeneity in recombinant COS4?

Glycosylation heterogeneity can significantly impact protein function and requires careful management:

  • Strain selection:

    • Use S. cerevisiae strains engineered for human-like glycosylation patterns

    • Consider glycosylation-deficient strains for non-glycosylated protein production

  • Site-directed mutagenesis:

    • Identify N-glycosylation sites (Asn-X-Ser/Thr) in COS4 sequence

    • Create mutants with altered glycosylation sites to study functional impact

  • Analytical assessment:

    • Mass spectrometry to characterize glycan structures

    • Lectin binding assays to profile glycosylation patterns

    • Glycosidase digestions to remove glycans for comparative studies

  • Homogeneity strategies:

    • Optimize culture conditions to reduce glycosylation heterogeneity

    • Employ endo-glycosidases for uniform glycan processing

S. cerevisiae has been genetically engineered to generate proteins with more human-like glycosylation patterns, providing researchers options for producing recombinant COS4 with glycosylation profiles suitable for various experimental purposes .

What advanced RNA interference techniques can be adapted to study COS4 function?

RNA interference (RNAi) approaches can be valuable for studying COS4 function, adapting techniques developed for other yeast proteins:

  • shRNA expression systems:

    • Design shRNA targeting COS4 mRNA with specific expression cassettes

    • Place under control of suitable promoters (e.g., U6) with appropriate leader sequences

    • Insert into expression vectors for S. cerevisiae transformation

  • Vector design considerations:

    • Include appropriate selectable markers

    • Optimize codon usage for yeast expression

    • Consider inducible promoters for temporal control

  • Delivery methods:

    • Standard yeast transformation techniques

    • Potential for oral administration in model organisms for in vivo studies

  • Validation approaches:

    • qRT-PCR to quantify COS4 mRNA reduction

    • Western blotting to confirm protein level reduction

    • Phenotypic assays to assess functional consequences

These RNAi techniques can be particularly valuable for studying COS4 function when used in conjunction with Core Outcome Sets (COS) approaches that standardize outcome measurements across related studies .

How can Core Outcome Set (COS) methodology enhance COS4 protein research?

While the acronym similarity is coincidental, Core Outcome Set methodology offers significant benefits for COS4 protein research:

  • Standardized outcome measurement:

    • Core Outcome Sets establish minimum outcomes that should be measured across all studies

    • Reduces heterogeneity in outcome measurement and reporting

    • Minimizes selective outcome reporting

  • Implementation in COS4 research:

    • Define critical outcomes for COS4 functional studies

    • Establish consensus on essential phenotypes to measure

    • Standardize biochemical and cellular assays across research groups

  • Development process:

    • Literature reviews to identify existing outcome measures

    • Consensus processes with stakeholder groups (Delphi studies)

    • Consideration of dissemination and uptake strategies

Applying COS methodology to COS4 research would enhance comparability across studies, facilitate evidence synthesis, and reduce research waste by ensuring that key outcomes are consistently measured and reported .

What are the main barriers to implementing standardized methodologies in COS4 research?

Based on research on Core Outcome Set implementation, the primary barriers likely to affect COS4 research include:

  • Knowledge barriers:

    • Poor knowledge about standardized methodologies (69% of surveyed researchers)

    • Difficulties identifying relevant methodological standards (68% of surveyed researchers)

  • Methodological concerns:

    • Perception of standardized approaches as restrictive

    • Concerns about excessive outcome measurements

    • Challenges in balancing standardization with innovation

  • Implementation enablers:

    • Clear understanding of methodology benefits (82% of researchers)

    • Perceived importance of standardization (71% of researchers)

Addressing these barriers would require dedicated educational initiatives, easily accessible resources on COS4 research standards, and demonstration of the benefits of methodological standardization for advancing the field.

What emerging technologies will advance recombinant COS4 protein research?

Several cutting-edge technologies show promise for advancing COS4 research:

  • CRISPR-Cas9 genome editing:

    • Precise manipulation of COS4 gene and regulatory elements

    • Creation of tagged variants at endogenous loci

    • Multiplexed editing to study interactions with other COS family members

  • Single-cell technologies:

    • Analysis of cell-to-cell variation in COS4 expression

    • Correlation of expression with cellular phenotypes

    • Spatial and temporal mapping of COS4 localization

  • Structural biology advances:

    • Cryo-EM for high-resolution structural studies

    • Integrative structural biology combining multiple techniques

    • Structure-based design of COS4 variants with altered properties

  • Automation and high-throughput approaches:

    • Automated experimental designs

    • Systematic testing of multiple conditions

    • Machine learning for pattern discovery in complex datasets

These technologies, particularly when combined with standardized research approaches, have the potential to significantly accelerate our understanding of COS4 biology and applications.

How can predictive algorithms enhance reproducibility in COS4 research?

Advanced predictive algorithms can address key challenges in research reproducibility:

  • Algorithmic approaches to prediction:

    • Development of computational methods to predict experimental outcomes

    • Assessment of result reliability before conducting experiments

    • Identification of potential confounding factors

  • Implementation in COS4 research:

    • Prediction of protein expression levels under various conditions

    • Assessment of likelihood of successful protein folding

    • Forecasting of experimental variability based on historical data

  • Validation framework:

    • Systematic comparison of predicted and actual outcomes

    • Refinement of algorithms based on experimental feedback

    • Integration of diverse data types for improved predictions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.