Recombinant Saccharomyces cerevisiae Protein COS5 (COS5)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli and purified under denaturing conditions, followed by lyophilization . Reconstitution recommendations:

  • Solubility: Use sterile deionized water at 0.1–1.0 mg/mL.

  • Stability: Add 5–50% glycerol for long-term storage .

Contextual Research Advancements

Recent studies on S. cerevisiae recombinant protein production highlight strategies relevant to COS5:

Study FocusKey FindingsImplications for COS5
Secretory pathway engineeringOverexpression of ERO1 (thiol oxidase) enhances disulfide bond formation, increasing secretory protein yields by 2-fold .Potential to improve COS5 folding efficiency if produced in yeast.
Cell polarizationBUD1 overexpression increases α-amylase secretion by 49% via enhanced vesicle transport .Suggests pathways to optimize COS5 trafficking.
Metabolic optimizationCYS4 overexpression boosts cysteine-rich proteins (e.g., α-amylase) by 2.14-fold .Applicable if COS5 contains cysteine-rich regions.
Genome-scale modelingConstraining retro-translocation enzymes (e.g., Hrd1) reduces ER stress from misfolded proteins .Critical for scaling COS5 production in yeast.

Limitations and Future Directions

  • Current Constraints: COS5 is produced in E. coli, limiting post-translational modifications (e.g., glycosylation) available in yeast systems .

  • Opportunities:

    • Adopt yeast-specific promoters (e.g., TEF1 or TPI1) for higher expression in S. cerevisiae .

    • Engineer secretion signals (e.g., α-factor leader) to redirect COS5 to extracellular space .

    • Leverage yeast strain diversity for improved folding or stability .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
COS5; YJR161C; J2410; Protein COS5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-383
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COS5
Target Protein Sequence
MKENELKNEKSVDVLSFKQLESQKIVLPQDLFRSSFTWFCYEIYKSLAFPIWMLLWLPLS VWWKLSNNCIYPLIVSLLVLFLGPIFVLVICGLSRKRSLSKQLIQFCKEVTENTPSSDPH DWEVVAANLNSYLYENKAWNTRYFFFNAMGCQEAFRTTLLEPFSLKKDEAAKVKSFKDSV PYIEEALGVYFREVEKQWKLFNTEKSWSPVGLEDVQLPKDIHRSKLTWFLKRIFTIYSLP LWLAFLNCICVSQHFCLAFRILCPGLFFLMMVWLFQNMRTTALLVKMEHKMQFLLTIINE QESGANGWDEIARKMNRYLFEKKAWKNEEFFFEGIDCEWFFSHFFYRLLSAKKSMWLLPL NVELWPYIKEAQLSRNEESLMKK
Uniprot No.

Target Background

Database Links

KEGG: sce:YJR161C

STRING: 4932.YJR161C

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Protein COS5 and what are its biological functions?

COS5 is a protein encoded by the COS5 gene in Saccharomyces cerevisiae (budding yeast). While specific information about COS5's function is limited in the provided search results, S. cerevisiae proteins are generally studied within the context of the organism's cellular processes. Recombinant forms of yeast proteins like COS5 are commonly produced with tags (such as His-tags) to facilitate purification and functional characterization .

Methodologically, researchers seeking to understand COS5 function should employ comparative genomics approaches, protein-protein interaction studies, and phenotypic analyses of knockout strains. The high frequency of homologous DNA recombination in S. cerevisiae makes it particularly amenable to genetic manipulation for functional studies .

What expression systems are optimal for producing recombinant COS5 protein?

S. cerevisiae itself serves as an excellent expression system for producing its native proteins in recombinant form. The organism has become a preferred choice for expressing eukaryotic proteins with improved properties . For COS5 specifically, expression can be optimized using high-copy plasmids with appropriate selection markers, such as the POT1 gene from Schizosaccharomyces pombe that complements TPI1 mutation, allowing for stable expression in rich media and high plasmid stability .

When designing expression systems for COS5 production, researchers should consider:

  • Promoter strength and regulation

  • Signal peptides for secretion

  • Codon optimization

  • Selection markers and growth conditions

  • Post-translational modification requirements

How can I verify the expression and purification of recombinant COS5 protein?

Verification of COS5 expression and purification can be accomplished through multiple complementary techniques:

  • Western blotting with anti-His antibodies (if His-tagged)

  • Flow cytometry analysis with appropriate antibodies (similar to methods described for other S. cerevisiae proteins)

  • Mass spectrometry for protein identification and characterization

  • Activity assays, if the function of COS5 is known

For immunostaining protocols similar to those used for other S. cerevisiae proteins, researchers can wash cells with phosphate-buffered saline (PBS, pH 7.0), suspend in PBS with 1 mg/mL bovine serum albumin at OD600 of 1.0, and add appropriate antibodies at 1:500 dilution at 25°C for 1 hour. After immunostaining, cells should be harvested, washed twice with PBS, and analyzed using flow cytometry .

How can directed evolution approaches be applied to optimize COS5 protein properties?

S. cerevisiae provides an exceptional platform for directed evolution of proteins due to its high frequency of homologous DNA recombination with proof-reading activity . For COS5 optimization, researchers can employ several sophisticated approaches:

  • In vivo DNA shuffling based on S. cerevisiae's recombination machinery

  • In vivo Assembly of Mutant libraries (IvAM) to combine multiple mutant libraries with different mutational spectra

  • In vivo Overlap Extension (IVOE) for site-directed mutagenesis studies

These methods exploit S. cerevisiae's ability to recombine overlapping DNA fragments in vivo, avoiding tedious ligation steps. To implement this approach for COS5:

  • Engineer overlapping areas of approximately 40 bp homology with linearized vector ends

  • Design mutagenic primers that generate PCR products with homologous regions

  • Transform PCR fragments into yeast with linearized plasmid to promote in vivo DNA recombination

The recombination efficiency is influenced by the length of overlapping ends in the crossover region, with at least 40 base pairs necessary to achieve recombination efficiencies over 60% .

What computational models can predict optimal conditions for COS5 production?

Advanced computational modeling can significantly enhance recombinant COS5 protein production. The proteome-constrained genome-scale protein secretory model of yeast (pcSecYeast) represents a significant advancement for rational design of recombinant protein production systems .

This model enables:

  • Simulation of phenotypes caused by limited secretory capacity

  • Prediction of overexpression targets for production optimization

  • Understanding of the energetic costs of processing proteins through the secretory pathway

For COS5 production, researchers could adapt the pcSecYeast model by:

  • Adding corresponding recombinant protein production and secretion reactions

  • Simulating maximum protein secretion under various growth rates

  • Identifying protein levels whose increase would result in increased recombinant protein production

Predicted overexpression targets would likely include proteins involved in sorting, ER-Golgi transport, and translocation from cytosol to ER, which have been shown to be generally important in protein secretion .

How does cellular polarization affect COS5 protein production and what engineering strategies can address this?

Cellular polarization in S. cerevisiae significantly impacts recombinant protein production. Engineering cell polarization pathways can be a strategic approach to improve COS5 production .

Methodological considerations include:

  • Genetic manipulation of polarization genes through fusion PCR

  • Integration of optimized expression cassettes into the genome

  • Analysis of protein localization and secretion efficiency

Researchers can construct expression cassettes through fusion PCR, amplifying promoters, terminators, homologous sequences, and cell polarization genes from the S. cerevisiae genome . The impact of these modifications on COS5 production can be evaluated through quantitative analyses of protein yield and cellular localization.

What are the optimal experimental conditions for studying COS5 protein interactions?

When designing experiments to study COS5 protein interactions, researchers should consider multiple variables:

  • Buffer compositions:

    • Phosphate-buffered systems at pH 7.0 with BSA (1 mg/mL) have been shown to be effective for immunostaining protocols

    • Consider adding protease inhibitors to prevent degradation

  • Temperature conditions:

    • Standard yeast cultivation at 30°C

    • Protein interaction studies typically at 25°C

  • Analytical techniques:

    • Flow cytometry for cellular localization studies

    • Pull-down assays for protein-protein interactions

    • Structural studies (X-ray crystallography, cryo-EM) for detailed interaction mapping

These conditions should be optimized based on the specific properties of COS5 and its potential interaction partners.

How can I troubleshoot low yields of recombinant COS5 protein?

Low yields of recombinant COS5 protein could be addressed through systematic troubleshooting:

  • Secretory pathway optimization:

    • Overexpress components involved in sorting, ER-Golgi transport, and translocation, which have been shown to enhance secretion of various recombinant proteins

    • Target proteins in the ER-Golgi transport machinery, as these have been identified as limiting factors

  • Metabolic engineering:

    • Analyze the amino acid composition of COS5 and overexpress enzymes involved in synthesis of overrepresented amino acids

    • For instance, if COS5 is cysteine-rich, overexpression of CYS4 (Cystathionine beta-synthase) could significantly increase production, as demonstrated for other recombinant proteins

  • Growth conditions optimization:

    • Maximum production rates for recombinant proteins are typically achieved at low specific growth rates

    • Avoid high specific growth rates where cells prioritize secretory pathway capacity for native proteins

  • Post-translational modification considerations:

    • If COS5 requires specific PTMs, ensure the corresponding pathways are not limiting

    • For glycosylated proteins, consider optimizing glycosylation pathways

What advanced analytical techniques are most appropriate for characterizing COS5 protein structure and function?

Comprehensive characterization of COS5 requires integration of multiple analytical approaches:

  • Structural analysis:

    • X-ray crystallography for high-resolution static structure

    • Nuclear Magnetic Resonance (NMR) for dynamic structural information

    • Cryo-electron microscopy for larger complexes

  • Functional characterization:

    • Activity assays specific to the predicted function of COS5

    • Binding assays if COS5 is involved in protein-protein interactions

    • CRISPR-Cas9 knockout studies to assess phenotypic effects

  • Localization studies:

    • Fluorescent tagging followed by confocal microscopy

    • Subcellular fractionation and western blotting

    • Immunogold labeling and electron microscopy for ultrastructural localization

How should researchers interpret contradictory data regarding COS5 function or interactions?

When faced with contradictory data regarding COS5:

  • Systematic validation:

    • Reproduce experiments using multiple independent approaches

    • Vary experimental conditions to identify context-dependent effects

    • Use both in vivo and in vitro approaches to validate findings

  • Control analysis:

    • Implement appropriate positive and negative controls for each experiment

    • Include wild-type comparisons and empty vector controls

  • Statistical rigor:

    • Apply appropriate statistical tests to determine significance

    • Consider biological versus technical replicates in experimental design

    • Perform power analyses to ensure adequate sample sizes

  • Literature reconciliation:

    • Compare methodologies used in conflicting studies

    • Consider strain differences, growth conditions, and analytical methods

    • Assess whether contradictions represent true biological variability or methodological discrepancies

What computational approaches can help integrate multi-omics data to understand COS5 function in the context of cellular networks?

Integrating multi-omics data for COS5 functional characterization requires sophisticated computational approaches:

  • Network analysis:

    • Protein-protein interaction networks to identify functional modules

    • Gene co-expression networks to identify co-regulated genes

    • Metabolic flux analysis to understand impact on cellular metabolism

  • Multi-omics integration:

    • Weighted correlation network analysis to identify relationships across data types

    • Bayesian network modeling to infer causal relationships

    • Machine learning approaches to identify patterns across datasets

  • System-level modeling:

    • Integration with genome-scale models like pcSecYeast

    • Constraint-based modeling to predict phenotypic outcomes

    • Kinetic modeling of pathway dynamics

These computational approaches can help contextualize COS5 within broader cellular networks and predict its impact on cellular physiology.

How might CRISPR-Cas9 technology advance our understanding of COS5 protein function?

CRISPR-Cas9 technology offers powerful approaches for studying COS5 function:

  • Precise genomic manipulation:

    • Creation of knockout strains to assess phenotypic consequences

    • Introduction of point mutations to study structure-function relationships

    • Tagging endogenous COS5 with reporters for localization studies

  • High-throughput screening:

    • CRISPR interference (CRISPRi) for conditional knockdown studies

    • CRISPR activation (CRISPRa) for overexpression studies

    • CRISPR screens to identify genetic interactions

  • Methodological workflow:

    • Design guide RNAs targeting COS5 with high specificity

    • Transform S. cerevisiae with Cas9 and guide RNA constructs

    • Select and verify edited strains through sequencing

    • Perform phenotypic characterization and functional assays

The high efficiency of homologous recombination in S. cerevisiae makes it particularly amenable to CRISPR-based genome editing approaches .

What emerging technologies might revolutionize our ability to study COS5 protein dynamics in living cells?

Several cutting-edge technologies could transform our understanding of COS5 dynamics:

  • Advanced imaging techniques:

    • Super-resolution microscopy for nanoscale visualization

    • Light-sheet microscopy for 3D imaging with minimal phototoxicity

    • Single-molecule tracking for real-time dynamics

  • Protein engineering approaches:

    • Split fluorescent proteins to visualize protein-protein interactions

    • Optogenetic tools to control COS5 activity with light

    • Proximity labeling (BioID, APEX) to map protein interaction networks

  • In-cell structural biology:

    • In-cell NMR to observe structural changes in the native environment

    • Cryo-electron tomography for visualizing protein complexes in their cellular context

    • Mass spectrometry imaging for spatial proteomics

These technologies will enable researchers to observe COS5 function in its native cellular context with unprecedented resolution and precision.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.