Recombinant Saccharomyces cerevisiae Protein COS9 (COS9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is finalized during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
COS9; YKL219W; Protein COS9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-407
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
COS9
Target Protein Sequence
MQIVRSCNSNNKPLIPSSNWHIAIRMRGDGVKDRSIDVLSLKHFESQKVVLPQDLFMDNF TWMFYEFFKCFTFRTWLLLLLLMWLPGFLSQIKSINRIFPFKLCILVSCLVGIFLPNIYS FSHKSVLTNQLTQFSKEIVEHAPGTDTHDWETVAANLNSYFYENKAWNTEYFFFNAAECQ KAFRKVLLEPFSVKKDESSKIKSFGDSVPYIEEALQVYSTEFDKKWKLFNTEKVWSPDNL EHVQLPKKTYRYKFTWVLKRIFNLWLFPAFILFLACIYVSWDKGHLFRILCCGGGFLLMV RVFQNMRPFSMHMEDKMQFLSTIINEQESGANGWDEIAKKMNRYLFEKKVWTSEEFFFDG IDCEWFFNHFFYRLLSTKKPMFDRPLNVELWPYIKEAQLTRKQAPPV
Uniprot No.

Target Background

Database Links

KEGG: sce:YKL219W

STRING: 4932.YKL219W

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Saccharomyces cerevisiae Protein COS9 and how is it typically expressed?

Recombinant Saccharomyces cerevisiae protein expression systems provide an excellent eukaryotic platform for heterologous protein production. When expressing recombinant proteins in S. cerevisiae, researchers must consider targeted chromosomal integration strategies to ensure stable expression and proper functionality. Modern approaches utilize CRISPR-Cas9 editing techniques to achieve precise genomic integration of the target protein sequence . For targeted chromosomal integration, homology-dependent recombination (HDR) has shown efficiency rates of up to 74% when properly optimized . The expression can be designed either with native yeast promoters or through in-frame fusion with existing yeast genes, depending on the experimental goals and protein characteristics .

What are the key advantages of using S. cerevisiae for recombinant protein expression compared to other expression systems?

S. cerevisiae offers several distinct advantages as a recombinant protein expression host. First, as a eukaryotic organism, it provides proper post-translational modifications including glycosylation patterns that are more similar to higher eukaryotes than bacterial systems. Second, S. cerevisiae has GRAS (Generally Recognized As Safe) status, making it suitable for various applications . Third, yeast systems can be scaled efficiently for protein production using inexpensive bioprocesses . Fourth, with the advent of CRISPR-Cas9 gene editing technologies, targeted chromosomal integration in yeast has become significantly more efficient and precise compared to previous methods . The minimal off-target effects observed with CRISPR-Cas9 in yeast make it particularly valuable for research requiring high specificity . Finally, S. cerevisiae is genetically well-characterized with numerous genetic tools available, facilitating easier manipulation and characterization of expressed proteins.

How does the CRISPR-Cas9 system enable more efficient targeted integration of genes in yeast?

The CRISPR-Cas9 system has revolutionized genetic engineering in S. cerevisiae by significantly improving targeted chromosomal integration. The system consists of two main components: guide RNA (gRNA) and the Cas9 protein derived from Streptococcus pyogenes . The gRNA directs the Cas9 endonuclease to dock at target-specific recognition sites upstream of the protospacer-adjacent motif (PAM) in the genome . Once positioned, Cas9 creates precise double-strand breaks (DSBs) three nucleotides before the PAM site . These DSBs are then repaired through either Non-Homologous End Joining (NHEJ) or Homology Dependent Recombination (HDR) . For targeted gene integration, HDR is the preferred mechanism as it allows for precise insertion of donor DNA sequences at the break site when homologous sequences are provided . Research has demonstrated that CRISPR-Cas9 mediated targeted knock-in at multiple sites in S. cerevisiae can achieve efficiency rates as high as 74%, representing a significant improvement over traditional methods .

What is the optimal homology arm length for efficient CRISPR-Cas9 mediated integration of recombinant genes in S. cerevisiae?

Determining the optimal homology arm length is crucial for efficient gene integration. Research indicates that homology arms as short as 15 base pairs can achieve approximately 50% targeted knock-in efficiency in S. cerevisiae when used with CRISPR-Cas9 . This finding significantly streamlines the design process for integration constructs. When designing integration experiments, researchers should consider a gradient approach to homology arm length: 5, 10, 15, and 20 nucleotide homologous arms can be tested to determine the minimum required length for specific experimental conditions . The efficiency increases with longer homology arms, but this relationship is not linear and plateaus after reaching certain lengths. The optimization should be performed while considering both the target genomic locus and the size of the insert being integrated. For larger constructs like fluorescent protein genes (GFP, RFP), longer homology arms may be necessary to maintain high integration efficiency .

How can researchers validate successful integration of recombinant genes in the yeast genome?

Validation of successful gene integration requires a multi-step approach. Initially, PCR amplification of the targeted genomic region followed by restriction digestion analysis can provide rapid screening for successful integration events . For example, introducing specific restriction sites (such as EcoRI) within the integration construct allows for quick validation through restriction fragment analysis . The percentage of successful integration can be quantified using densitometry software such as ImageJ to analyze the resulting restriction fragments . For more comprehensive validation, whole-genome sequencing should be performed to confirm not only the presence of the integrated gene at the desired locus but also to verify the absence of off-target integrations elsewhere in the genome . Phenotypic validation is also crucial, especially for fluorescent protein integrations where microscopy can confirm proper expression and localization of the fusion proteins . Finally, functional assays specific to the protein of interest should be conducted to ensure the recombinant protein maintains its expected activity and characteristics.

What strategies can be employed to optimize expression levels of recombinant proteins in S. cerevisiae?

Optimizing expression levels requires consideration of multiple factors. First, selection of an appropriate genomic integration site significantly impacts expression levels, with some loci providing higher basal expression than others . The design of the expression construct is critical – using yeast codon-optimized sequences for heterologous proteins can substantially improve expression levels . For proteins requiring in-frame expression with endogenous yeast proteins, careful design of the fusion junction is essential to maintain proper protein folding and function . The choice of promoter significantly impacts expression levels – constitutive promoters like TEF1 provide consistent expression, while inducible promoters such as GAL1 allow for controlled expression timing. Optimization of culture conditions including media composition, temperature, and induction parameters can significantly improve protein yield and quality. Finally, consider co-expression of chaperones or foldases if the target protein has complex folding requirements. For each parameter, systematic optimization experiments should be conducted, varying one factor at a time to determine optimal conditions.

What are the common challenges in expressing recombinant proteins in S. cerevisiae and how can they be addressed?

Several challenges commonly arise when expressing recombinant proteins in yeast systems. Protein misfolding or aggregation often occurs with heterologous proteins, which can be addressed by optimizing growth temperature (typically lowering to 25-30°C), co-expressing molecular chaperones, or adding chemical chaperones to the culture medium. Low expression levels may result from codon usage bias, requiring codon optimization of the gene sequence for S. cerevisiae . Post-translational modifications may differ from the native protein, necessitating specific strain selection or engineering to achieve desired modification patterns. Proteolytic degradation can significantly reduce yield; this can be mitigated by using protease-deficient strains or adding protease inhibitors during extraction. Integration site effects, where the genomic location affects expression, require careful selection of integration loci based on desired expression levels . Construct design issues can be addressed through systematic optimization of the expression cassette, including testing various promoters, terminators, and secretion signals if applicable . For each challenge, a systematic troubleshooting approach should be implemented, testing one variable at a time while monitoring protein expression and quality.

How can researchers design a systematic approach to optimize CRISPR-Cas9 mediated integration for recombinant protein expression?

A systematic optimization approach involves several key steps. Begin with guide RNA (gRNA) design and optimization – design multiple gRNAs targeting the desired integration locus and screen them for efficiency . For homology arm optimization, test a range of homology arm lengths (15-50 bp) to determine the minimum required for efficient integration at your specific locus . The CRISPR-Cas9 delivery method should be optimized by comparing plasmid-based expression versus direct ribonucleoprotein (RNP) delivery. Donor DNA concentration significantly impacts integration efficiency; a concentration gradient experiment can determine the optimal amount for your specific construct . The transformation protocol should be optimized by adjusting parameters such as cell density, heat shock duration, and recovery conditions. Following integration, implement a robust screening strategy using PCR, restriction digestion, or reporter gene expression to identify successful integrants . Create a comprehensive data tracking system to record all experimental variables and outcomes, facilitating identification of optimal conditions. This table summarizes key parameters to optimize:

ParameterVariables to TestAssessment Method
gRNA designMultiple target sequencesCutting efficiency assay
Homology arm length15, 20, 30, 50 bpIntegration efficiency by PCR/restriction analysis
Donor DNA concentration0.1-5 μg rangeIntegration efficiency percentage
Transformation methodChemical, electroporationTransformation efficiency
Selection strategyDirect/indirect selectionRecovery of correct integrants

What are the potential off-target effects of CRISPR-Cas9 in S. cerevisiae and how can they be minimized?

Off-target effects represent a potential concern in CRISPR-Cas9 applications, though S. cerevisiae generally shows minimal off-target mutations compared to other organisms . To assess and minimize these effects, researchers should implement several strategies. Begin with careful gRNA design using validated computational tools that predict potential off-target sites based on sequence similarity. High-fidelity Cas9 variants (such as eSpCas9 or SpCas9-HF1) can be used to reduce off-target cutting. Whole-genome sequencing should be performed on selected integrants to comprehensively identify any off-target modifications . The gRNA concentration should be optimized, as excessive amounts can increase off-target activity. Using shorter gRNAs (17-18 nucleotides instead of standard 20) can improve specificity in some cases. Temporary expression of Cas9 (rather than constitutive) minimizes the window for off-target cutting. Research has demonstrated that with proper design and implementation, CRISPR-Cas9 systems in S. cerevisiae can achieve precise genome editing with no detectable off-target effects, as confirmed by whole-genome sequencing .

How should researchers approach the analysis of expression data for recombinant proteins in S. cerevisiae?

Analysis of expression data requires a comprehensive approach combining multiple analytical methods. Quantitative assessment should begin with protein yield determination using methods such as Bradford assay, BCA assay, or quantitative Western blotting with appropriate standards. Expression kinetics should be analyzed by collecting samples at multiple time points to determine optimal harvest time. For protein quality assessment, SDS-PAGE, size exclusion chromatography, and mass spectrometry provide complementary data on protein integrity and modifications. Functional analysis using protein-specific activity assays is essential to confirm that the recombinant protein maintains its expected biological function. For data interpretation, implementation of appropriate statistical analysis is crucial, including calculating means, standard deviations, and performing statistical tests (t-tests, ANOVA) to determine significant differences between experimental conditions. When comparing different expression conditions or constructs, normalization to appropriate controls is essential for valid comparisons. Multi-variate analysis can be valuable when optimizing multiple parameters simultaneously to identify key factors affecting expression. Finally, data visualization through graphs, charts, and heat maps can help identify patterns and optimal conditions for expression.

What metrics should be used to evaluate the efficiency of CRISPR-Cas9 mediated integration in S. cerevisiae?

Multiple metrics should be employed to comprehensively evaluate CRISPR-Cas9 integration efficiency. Integration efficiency should be calculated as the percentage of colonies with confirmed integration relative to total transformed colonies . This can be determined using PCR screening followed by restriction enzyme digestion if appropriate restriction sites were incorporated in the design . The accuracy of integration must be assessed through sequencing of the integration junctions to confirm precise insertion without insertions, deletions, or mutations . Off-target analysis using whole-genome sequencing of selected clones provides comprehensive assessment of specificity . Expression levels of the integrated gene should be quantified using qRT-PCR, Western blotting, or functional assays as appropriate for the specific protein. For fluorescent protein integrations, flow cytometry can provide quantitative data on expression levels across the population . Based on published research, expected integration efficiencies using optimized CRISPR-Cas9 methods in S. cerevisiae can reach 74% for small constructs and approximately 50% when using minimal 15 bp homology arms . The table below summarizes typical efficiency metrics for CRISPR-Cas9 integration in S. cerevisiae:

Homology Arm LengthTypical Integration EfficiencyConstruct Size
15 bp~50%Small (<100 bp)
20+ bp~74%Small (<100 bp)
40+ bp30-60%Medium (100-1000 bp)
60+ bp20-40%Large (>1000 bp)

What emerging technologies might enhance recombinant protein expression in S. cerevisiae beyond current CRISPR-Cas9 approaches?

Several promising technologies are emerging for enhancing recombinant protein expression in yeast. Base editing and prime editing technologies offer more precise genetic modifications without requiring double-strand breaks, potentially reducing disruption to cellular processes . Automated high-throughput strain engineering platforms combining robotic systems with CRISPR technologies can accelerate optimization by testing thousands of genetic variants simultaneously . Synthetic genomics approaches, including synthetic chromosome construction, offer unprecedented control over the genetic context of recombinant protein expression . CRISPR-Cas13 systems targeting RNA rather than DNA provide alternative regulatory mechanisms for controlling protein expression without permanent genomic modifications . Machine learning algorithms are increasingly being applied to predict optimal expression conditions and genetic modifications based on protein sequence characteristics. Synthetic biological circuits can create sophisticated expression control systems responding to specific environmental conditions or metabolic states. Genome-scale engineering approaches using multiplexed CRISPR systems allow simultaneous modification of multiple genomic loci, optimizing metabolic pathways supporting recombinant protein production . Cell-free expression systems derived from S. cerevisiae provide rapid prototyping capabilities for testing expression constructs before implementing them in living cells.

How might the core outcome set approach be adapted to standardize research on recombinant protein expression?

Adapting core outcome set (COS) methodology to recombinant protein expression research could significantly enhance standardization and reproducibility in the field. A comprehensive approach would begin with systematic review of the literature to identify all reported outcomes in recombinant protein expression studies . This should be supplemented with expert interviews across academia and industry to capture outcomes that matter to different stakeholders . A modified Delphi consensus process using a 5-point rating scale (which has shown greater efficiency in reaching consensus than 9-point scales) should be implemented to prioritize outcomes . The consensus process should include representatives from diverse research settings including academic labs, industry R&D, and regulatory bodies . Core outcomes should encompass multiple dimensions: protein characteristics (yield, purity, activity), process parameters (reproducibility, scalability), and research utility (ease of modification, stability). The standardized COS should be published in field-specific journals and repositories to encourage widespread adoption . Regular reviews and updates (every 3-5 years) should be scheduled to incorporate new methodologies and research priorities . Implementation tools such as standardized reporting templates and data collection instruments would facilitate adoption of the COS across the research community . This standardized approach would significantly enhance cross-study comparisons and meta-analyses, accelerating progress in recombinant protein expression technology.

What are the most promising applications of recombinant proteins expressed in S. cerevisiae for future research?

Recombinant proteins expressed in S. cerevisiae offer numerous promising research applications. Therapeutic protein production benefits from yeast's eukaryotic protein folding machinery and ability to perform post-translational modifications, making it suitable for producing complex biopharmaceuticals . Vaccine development utilizing recombinant yeast-expressed antigens offers advantages in safety, scalability, and cost-effectiveness . Enzyme production for industrial applications takes advantage of yeast's scalable cultivation and protein secretion capabilities . Structural biology research benefits from the ability to produce isotopically labeled proteins for NMR studies or difficult-to-express proteins for crystallography . Synthetic biology applications utilizing recombinant sensing proteins can create whole-cell biosensors for environmental monitoring or diagnostic applications . Metabolic engineering approaches can incorporate recombinant enzymes to create novel biosynthetic pathways for sustainable production of chemicals and materials . Protein interaction studies using techniques like yeast two-hybrid or protein complementation assays provide insights into protein function and cellular pathways. Disease modeling through expression of human disease-associated proteins in yeast can provide insights into pathological mechanisms . The precision offered by CRISPR-Cas9 integration methods significantly enhances the reliability and reproducibility of these applications by ensuring consistent expression from defined genomic loci .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.