Recombinant Saccharomyces cerevisiae Protein DFG16 (DFG16)

Shipped with Ice Packs
In Stock

Description

Definition and Basic Characteristics of Recombinant Saccharomyces cerevisiae Protein DFG16 (DFG16)

Recombinant DFG16 is a bioengineered version of the Saccharomyces cerevisiae protein encoded by the DFG16 gene (UniProt ID: Q99234). This 619-amino-acid protein is produced via heterologous expression systems, primarily in E. coli or yeast, and is purified to >85–90% purity . Key features include:

  • Structure: Predicted seven transmembrane domains and a long hydrophilic C-terminal region .

  • Function: Critical for pH sensing, genome stability, and alkaline pH adaptation in yeast .

  • Applications: Used in biochemical assays, protein interaction studies, and functional analysis of pH-responsive pathways .

CharacteristicDetailSource
Host OrganismE. coli (His-tagged) or yeast
Purity≥85% (SDS-PAGE verified)
StorageLyophilized powder stored at -20°C/-80°C with 50% glycerol
Sequence CoverageFull-length (1–619 aa) or partial truncations

Functional Roles of DFG16 in Biological Systems

DFG16 is integral to two conserved pathways:

pH-Responsive Pathway (Rim101 Signaling)

  • Primary Role: Facilitates proteolytic activation of Rim101p, a transcription factor regulating alkaline pH adaptation .

  • Mechanism: Forms a plasma membrane complex with Rim21p (pH sensor) and Rim9p to detect extracellular alkalinity .

  • Phenotypic Impact: Deletion of DFG16 leads to:

    • Accumulation of unprocessed Rim101p (~98 kDa vs. ~90 kDa processed form) .

    • Dysregulated expression of pH-responsive genes (e.g., NRG1, SMP1) .

    • Defective filamentation in Candida albicans .

Genome Stability and Recombination

  • Role: Maintains genome integrity by suppressing spontaneous hyper-recombination .

  • Interactions: YER188W (oxidative stress) and DFG16 (genome integrity) are linked to recombination control .

Experimental Uses

  • Protein-Protein Interactions: Studied interactions with Rim21p, Rim9p, and ESCRT components .

  • Enzymatic Assays: Used to characterize Rim101p processing in vitro .

  • Genetic Screens: Identified via genome-wide screens for hyper-recombination and pH defects .

Functional Partners

ProteinInteraction TypePathway RoleSource
Rim21pDirect bindingpH sensing and Rim101p stabilization
Rim9pPlasma membrane complexMaintaining Rim21p localization
ESCRT componentsIndirect regulationMultivesicular body (MVB) formation

pH Sensing and Adaptation

  • Critical for Alkaline Response: dfg16Δ mutants fail to suppress Rim101p-repressed genes (e.g., YJR061W, YOR389W) under alkaline conditions .

  • Conservation: Functional homologs include Aspergillus nidulans PalH and Candida albicans Dfg16p .

Genome Integrity

  • Hyper-Recombination: dfg16Δ strains exhibit elevated spontaneous recombination rates, linked to defective DNA repair or replication fork stability .

  • GO Term Enrichment: Genome-wide screens associate DFG16 with terms like "DNA repair" and "genome integrity" .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please contact your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the protein's intrinsic stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
DFG16; ECM41; ZRG11; YOR030W; OR26.20; Protein DFG16; Extracellular mutant protein 41; Zinc-regulated gene 11 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-619
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
DFG16
Target Protein Sequence
MIIRLHFYYLLTLVYHLGLVGAYEKAARKRIQPPDLIPGPPGHKLGDERPPHYDHRPPYK KHIDNIPAYNLTDLIDDKLLNKYENSCTVNVLTGGFISLASNSWHLRAYNYTLNYPSFLI RCDNGSANPNFSHVLQDFVYDINNKFNVQDDSSKYIGKDPFPLGMIMITFASGCICVATW MLFLVVLLLPSDNHNRRNKVVHVYVLFSAIIRTVFLNETIAVIFDSQYHDDYQDASQFES FIVETAPYKICELVANILSDINWIYIVHYLQSNYGKPTWNWIPFKMKKGTHIIITVGCFL SLADNILFANLLWRKNLVVLKVFYKLIELLIYTIFISIICYFTWHNFAYILLPKTAEINT DGKCKTKLRILWENYHETIPLLAYNILIFILFYFTTIFFAAFTKHVRGWTFNFVHLLKVL ITVNVWGLIGVLEKRELHISKKTVLGRKINNRDKFFANPTVNYYGEDLGKHLSAITLNRD LNTTKSNTTSHDSSSLVGSPSPTWKSPIERIRDRRRRHKIMKSENKFGQNPSFGSKSNGK PNTKTTLSKYRQLLRKPRRKTNSYEPKNGIGQNKEGSTVRPGADKHIRDSNYLATDISDN ESMETELRTNHIYNYENSD
Uniprot No.

Target Background

Function
Plays a role in invasion during filamentous growth.
Gene References Into Functions
  1. An S. cerevisiae dfg16Delta mutant exhibits elevated expression of Rim101p-repressed genes. PMID: 15879523
Database Links

KEGG: sce:YOR030W

STRING: 4932.YOR030W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is DFG16 and what is its primary function in Saccharomyces cerevisiae?

DFG16 is a gene that encodes a membrane protein required for the Rim101p pH response pathway in Saccharomyces cerevisiae. The primary function of Dfg16p is to facilitate the proteolytic processing of the Rim101p transcription factor, which is necessary for its activation. Unprocessed Rim101p is approximately 98 kDa, while the processed, active form is approximately 90 kDa .

Dfg16p is predicted to contain seven membrane-spanning segments and a long hydrophilic C-terminal region, suggesting it may function as a G-protein-coupled receptor. It serves as a potential environmental pH sensor that promotes Rim101p processing, allowing the yeast to adapt to changes in environmental pH .

How does DFG16 relate to other components of the Rim101p pathway?

DFG16 is one of three predicted membrane proteins that function in the Rim101p pathway, alongside Rim21p, which shares functional similarities with Dfg16p. Both proteins are required for the normal processing of Rim101p and subsequent regulation of Rim101p-dependent genes .

Genetic and functional analyses have revealed that mutations in DFG16 produce phenotypes similar to those observed in rim101Δ mutants. Microarray analysis of dfg16Δ, rim101Δ, rim21Δ, and snf7Δ mutants showed highly correlated changes in gene expression patterns (Pearson coefficient of 0.987 between dfg16Δ and rim101Δ), confirming that Dfg16p functions in the same pathway as Rim101p .

What experimental evidence supports the role of DFG16 in Rim101p processing?

Several lines of experimental evidence support the role of DFG16 in Rim101p processing:

  • Western blot analysis of Rim101p in dfg16Δ mutants shows accumulation of only the unprocessed form (~98 kDa) of Rim101p, while wild-type strains predominantly accumulate the processed form (~90 kDa) .

  • Gene expression analysis demonstrates that dfg16Δ mutants express Rim101p-repressed genes at elevated levels, similar to rim101Δ mutants .

  • Northern analysis confirms increased expression of NRG1 and SMP1 (direct Rim101p repression targets) in dfg16Δ mutants, consistent with defective Rim101p processing and function .

  • In Candida albicans, dfg16Δ/dfg16Δ mutants are defective in alkaline pH-induced filamentation, a phenotype that can be suppressed by expression of truncated Rim101-405p (constitutively active form) .

What genetic interactions have been identified for DFG16 in genome-wide studies?

Quantitative genetic interaction analysis has positioned DFG16 within the functional landscape of the yeast genome. Using Synthetic Genetic Array (SGA) methodology, researchers have identified numerous genetic interactions involving DFG16 .

The SGA score, which captures single- and double-mutant fitness measurements, has revealed both positive and negative genetic interactions between DFG16 and other genes. These interactions have been validated using functional benchmarks such as Gene Ontology (GO) biological process terms and protein-protein interactions .

Interaction TypeDescriptionFunctional Implication
Negative Genetic InteractionsGenes whose deletion exacerbates the dfg16Δ phenotypeLikely function in parallel or compensatory pathways
Positive Genetic InteractionsGenes whose deletion suppresses the dfg16Δ phenotypeMay indicate functional relationships across distinct protein complexes

Genetic interaction profile analysis places DFG16 in proximity to other genes involved in pH sensing and response, further confirming its role in the Rim101p pathway .

How does DFG16 function relate to the multivesicular body (MVB) pathway?

DFG16 functions specifically in the Rim101p pathway and does not appear to have a role in the multivesicular body (MVB) pathway, despite the intersection between these two pathways. FM4-64 staining experiments indicate that dfg16Δ mutants do not exhibit MVB defects .

Researchers have developed criteria to distinguish genes at the Rim101p-MVB pathway intersection from those specific to either pathway. Two transcripts, PRY1 and ASN1, respond to mutations affecting both pathways but not to mutations affecting only one pathway. The dfg16Δ mutation does not affect PRY1 and ASN1 expression, confirming that Dfg16p function is restricted to the Rim101p pathway .

This distinction is important because several proteins required for processed Rim101p accumulation are members of the ESCRT complex, which functions in MVB formation. Snf7p, for example, functions in both pathways. The evolutionary co-option of the complex ESCRT machinery to participate in Rim101p processing represents an intriguing case of pathway intersection .

What structural features of DFG16 contribute to its function as a potential pH sensor?

DFG16 encodes a protein with seven predicted membrane-spanning segments and a long hydrophilic C-terminal region. This structure is consistent with that of a G-protein-coupled receptor, suggesting that Dfg16p may directly sense environmental pH changes .

The membrane localization of Dfg16p positions it ideally to detect extracellular pH changes. The seven transmembrane domains likely form a structure that undergoes conformational changes in response to pH variations, triggering downstream signaling events that ultimately lead to Rim101p processing.

Dfg16p shares structural similarities with Aspergillus nidulans PalH, a component of the well-characterized PacC processing pathway, further supporting its role as a pH sensor. The conservation of this structure across fungal species indicates its fundamental importance in pH adaptation mechanisms .

How can researchers generate and validate dfg16Δ mutants for functional studies?

To generate and validate dfg16Δ mutants for functional studies, researchers can employ the following methodological approaches:

  • Gene Deletion Strategy:

    • Use PCR-based gene replacement techniques to substitute the DFG16 open reading frame with a selectable marker (e.g., URA3, KanMX4)

    • Design primers with 40-50 bp homology to regions flanking the DFG16 gene

    • Transform the PCR product into wild-type yeast cells and select on appropriate media

  • Validation of Deletion:

    • Perform diagnostic PCR using primers that anneal outside the deleted region

    • Sequence across deletion junctions to confirm proper integration

    • Verify deletion at the protein level using epitope-tagged Rim101p constructs

  • Phenotypic Confirmation:

    • Assess growth on alkaline pH media (pH 8.0)

    • Examine haploid invasive growth capability, which is known to require Dfg16p

    • Analyze expression of Rim101p-repressed genes (e.g., NRG1, SMP1) via Northern blotting or qRT-PCR

  • Complementation Testing:

    • Transform dfg16Δ mutants with plasmids expressing wild-type DFG16

    • Assess restoration of Rim101p processing and pH-responsive phenotypes

    • Include controls with empty vectors and unrelated genes

What experimental approaches can be used to study the role of DFG16 in Rim101p processing?

Several experimental approaches can be employed to study DFG16's role in Rim101p processing:

  • Biochemical Analysis of Rim101p Processing:

    • Express epitope-tagged versions of Rim101p (e.g., Rim101-HA2p, Ura3-V5-Rim101p) in wild-type and dfg16Δ strains

    • Prepare protein extracts and analyze by immunoblotting to detect processed (90 kDa) and unprocessed (98 kDa) forms

    • Quantify the ratio of processed to unprocessed Rim101p under various pH conditions

  • Transcriptional Analysis:

    • Perform microarray or RNA-seq analysis on wild-type and dfg16Δ strains grown under standard (pH 6.6) and alkaline (pH 8.0) conditions

    • Focus on expression changes in known Rim101p-regulated genes like NRG1, SMP1, YJR061W, YOR389W, and YPL277C

    • Validate expression changes using Northern blotting or qRT-PCR

  • Genetic Epistasis Analysis:

    • Generate double mutants combining dfg16Δ with mutations in other Rim101p pathway components

    • Express constitutively active Rim101p (e.g., truncated Rim101-405p) in dfg16Δ backgrounds to test for suppression

    • Analyze phenotypes and Rim101p processing in these genetic backgrounds

  • Cross-Species Functional Analysis:

    • Test functional conservation by examining dfg16Δ/dfg16Δ mutants in Candida albicans

    • Assess pH-induced filamentation and other Rim101p-dependent phenotypes

    • Perform complementation experiments with DFG16 homologs from different fungal species

How can quantitative genetic interaction analysis be applied to study DFG16 function?

Quantitative genetic interaction analysis provides powerful insights into DFG16 function through the following methodological approaches:

  • Synthetic Genetic Array (SGA) Analysis:

    • Create a dfg16Δ query strain and cross it with an array of deletion mutants covering the yeast genome

    • Use automated procedures to select double mutants

    • Measure colony size as a proxy for fitness and calculate genetic interaction scores

  • Data Normalization and Statistical Analysis:

    • Apply normalization procedures to remove systematic biases in colony size measurements

    • Use spatial smoothing, quantile normalization, and linear discriminant analysis to reduce variability

    • Calculate SGA scores that capture genetic interactions while controlling for single-mutant fitness effects

  • Interpretation of Genetic Interactions:

    • Identify negative interactions (synthetic sick/lethal) where double mutants show greater fitness defects than expected

    • Identify positive interactions (suppressive) where double mutants show better fitness than expected

    • Analyze genetic interaction profiles to place DFG16 in a functional context

  • Validation of Genetic Interactions:

    • Confirm key interactions using targeted gene deletions and alternative fitness measurements

    • Assess functional relevance using Gene Ontology enrichment analysis

    • Integrate genetic interaction data with physical interaction networks to identify pathway connections

What expression systems are most effective for producing recombinant DFG16 protein?

For producing recombinant DFG16 protein, researchers should consider the following expression systems and strategies:

  • Yeast Expression Systems:

    • Homologous expression in S. cerevisiae using strong inducible promoters (GAL1, CUP1)

    • Consider using a protease-deficient strain (e.g., pep4Δ) to minimize degradation

    • Include epitope tags (His6, FLAG, HA) for purification and detection

    • Express in a dfg16Δ background to assess functionality of the recombinant protein

  • Membrane Protein Considerations:

    • DFG16 encodes a protein with seven predicted membrane-spanning segments, making it challenging to express and purify

    • Consider expressing truncated versions containing specific domains for structural studies

    • Use detergents (DDM, CHAPS, Fos-choline) for membrane protein solubilization

    • Employ nanodiscs or amphipols for maintaining native-like membrane environment

  • Purification Strategy:

    • Implement two-step affinity purification using tandem affinity tags

    • Optimize detergent concentration to maintain protein stability and activity

    • Consider size exclusion chromatography as a final purification step

    • Verify protein integrity by mass spectrometry and N-terminal sequencing

  • Functional Validation:

    • Assess whether purified protein can complement dfg16Δ mutant phenotypes when reintroduced

    • Develop in vitro assays to test potential pH-sensing capabilities

    • Examine protein-protein interactions with other Rim101p pathway components

What approaches can be used to investigate DFG16's potential role as a pH sensor?

To investigate DFG16's potential role as a pH sensor, researchers can employ several strategic approaches:

  • pH-Dependent Conformational Studies:

    • Express and purify recombinant DFG16 protein in membrane mimetics

    • Use circular dichroism (CD) spectroscopy to detect pH-dependent structural changes

    • Employ hydrogen-deuterium exchange mass spectrometry to identify regions with altered solvent accessibility at different pH values

    • Perform fluorescence resonance energy transfer (FRET) analysis with strategically placed fluorophores to detect conformational changes

  • Structure-Function Analysis:

    • Generate site-directed mutations in conserved residues potentially involved in pH sensing

    • Create chimeric proteins by swapping domains with other pH sensors

    • Assess functionality of mutant and chimeric proteins in dfg16Δ backgrounds

    • Correlate structural features with pH-responsive phenotypes

  • Localization and Trafficking Studies:

    • Generate GFP-tagged DFG16 constructs to track protein localization

    • Examine changes in localization pattern in response to pH shifts

    • Use pH-sensitive fluorescent probes to correlate local pH with DFG16 activity

    • Perform time-lapse microscopy to monitor dynamic responses to pH changes

  • Protein-Protein Interaction Analysis:

    • Identify pH-dependent interactions using co-immunoprecipitation at various pH values

    • Employ split-ubiquitin or split-GFP assays for membrane protein interactions

    • Perform proximity labeling experiments (BioID, APEX) to identify proteins in close proximity to DFG16 under different pH conditions

    • Validate key interactions using in vitro binding assays with purified components

How might understanding DFG16 function advance our knowledge of fungal pH adaptation mechanisms?

Understanding DFG16 function has significant implications for our knowledge of fungal pH adaptation:

  • Evolutionary Conservation of pH Response Mechanisms:

    • DFG16 is functionally conserved across fungal species, including the pathogenic Candida albicans

    • Comparative analysis of DFG16 homologs may reveal evolutionary adaptations in pH sensing

    • Understanding conserved mechanisms provides insight into fundamental aspects of fungal environmental adaptation

  • Integration of Signaling Pathways:

    • The relationship between the Rim101p pathway and the MVB pathway represents an intriguing case of pathway intersection

    • Further characterization of DFG16 may reveal additional cross-talk between signaling pathways

    • This could provide insight into how fungi integrate multiple environmental signals

  • Structure-Function Relationships in Membrane Sensors:

    • Detailed characterization of DFG16's structure and mechanism of action would enhance our understanding of how membrane proteins sense environmental signals

    • This could inform the design of targeted antifungal compounds that disrupt pH adaptation

  • Systems Biology Perspectives:

    • Comprehensive analysis of genetic interactions involving DFG16 would place it within the broader cellular network

    • This would contribute to systems-level understanding of how fungi maintain pH homeostasis and adapt to environmental changes

What are the implications of DFG16 research for understanding pathogenic fungi?

Research on DFG16 has important implications for understanding pathogenic fungi:

  • Virulence Mechanisms in Candida albicans:

    • DFG16 is required for alkaline pH-induced filamentation in C. albicans, a process linked to virulence

    • pH adaptation is crucial for pathogens that encounter varying pH environments within the host

    • Understanding DFG16's role may reveal vulnerabilities that could be targeted therapeutically

  • Host-Pathogen Interactions:

    • Fungal pathogens must adapt to the pH of different host niches

    • DFG16-dependent pH sensing may be critical for adaptation during infection

    • This understanding could lead to novel strategies for preventing or treating fungal infections

  • Antifungal Drug Development:

    • The conservation of DFG16 across fungal species makes it a potential target for broad-spectrum antifungals

    • Structural characterization could facilitate structure-based drug design

    • Targeting pH adaptation pathways represents a novel approach to antifungal therapy

  • Biofilm Formation and Drug Resistance:

    • pH adaptation has been linked to biofilm formation in several fungal species

    • DFG16-dependent pathways may contribute to the development of drug-resistant biofilms

    • Targeting these pathways could enhance the efficacy of existing antifungal treatments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.