Recombinant Saccharomyces cerevisiae Protein ECM12 (ECM12)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Protein ECM12 (ECM12)

Saccharomyces cerevisiae Protein ECM12 (ECM12) is a protein found in the yeast Saccharomyces cerevisiae . It is identified as YHR021W-A and L000003887 . ECM12 is suggested to participate in cell wall biosynthesis, with mutants showing zymolyase hypersensitivity, though its precise function remains largely unknown .

Biochemical and Genetic Analysis of ECM12

ECM12 is part of the M14 family of metallocarboxypeptidases (MCPs) and is considered a pseudoenzyme predicted to lack enzyme activity . Despite lacking detectable enzymatic activity, ECM12 is secreted from cells and processed into a mature form by an endopeptidase .

2.2. Evolutionary Conservation

ECM12 is conserved within the ascomycete branch of the fungal kingdom . While many carboxypeptidase-like proteins from Basidiomycota are identified as a sister clade to Ecm14, several active site substitutions suggest that many of these proteins are inactive enzymes as well .

Potential Functions and Roles

Research indicates that ECM12 may be involved in vesicle-mediated transport and aggregate invasion, a process not favored in modern laboratory strains of S. cerevisiae .

ECM12 and Extracellular Matrix (ECM)

Proteins related to the extracellular matrix (ECM) are crucial in various biological processes, including cell differentiation . ECM12 is proposed to function in the extracellular matrix . ECM proteins like laminins and vitronectin have been used as substrates for cell differentiation, showing promise in retinal pigment epithelium (RPE) cell generation for treating retinal degeneration .

Expression and Detection

Ecm14-His6 expression can be induced in S. cerevisiae using a galactose-inducible promoter from the plasmid pEMBLyEx4, resulting in detectable pro-Ecm14 and mature Ecm14 forms via anti-His6 western blotting .

Interactions

ECM12 has a known interaction with MRPL17 .

Data Table: Key Features of ECM12

FeatureDescription
Protein NameECM12 (Saccharomyces cerevisiae Protein ECM12)
SynonymsYHR021W-A, L000003887
FunctionPutative role in cell wall biosynthesis, may contribute to vesicle-mediated transport and aggregate invasion
Enzyme ActivityPseudoenzyme, predicted to lack enzyme activity
Molecular Weight~45 kDa (pro-Ecm14), ~35 kDa (mature Ecm14)
Post-translational ModificationN-glycosylation at two sites
LocalizationSecreted, extracellular matrix
FamilyM14 family of metallocarboxypeptidases (MCPs)
InteractionsInteracts with MRPL17

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECM12; YHR021W-A; Protein ECM12; Extracellular mutant protein 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-151
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ECM12
Target Protein Sequence
MNRSFHFLIKYIYIHVLLVFYFHIKQQAIMPFFIFFFSSFDGLSFDLRVVAFLAKHVFVG VCSPFFVVGFFGSSRVVVTEWLSKLVLPPPPVSITQVFSLSRKRGEFSSGYILIINPYKS FLRSLLDFSIFNNTAKNKSSTFTLNLEDVSK
Uniprot No.

Target Background

Function
Potentially involved in cell wall organization and biogenesis.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Protein ECM12 and what is its structural composition?

ECM12 is a protein from the yeast Saccharomyces cerevisiae that appears to be associated with the extracellular matrix (ECM). According to the Creative BioMart database, the full-length ECM12 protein consists of 151 amino acids . While the specific function of ECM12 isn't extensively characterized in the literature, its "ECM" designation suggests involvement in cell wall organization or extracellular matrix interactions, which are critical components of yeast cellular structure.

The extracellular matrix typically contains various protein components as shown in this composition table from mammalian ECM:

ProteinPercent Composition
Collagen(s)50–90
Elastin0.6–7.9
Fibronectin<1.0
Laminin<1.0

Source: The Role of the Extracellular Matrix (ECM) in Wound Healing

What expression systems are optimal for producing recombinant ECM12 protein?

Saccharomyces cerevisiae is an excellent host for producing its native ECM12 protein, as it possesses the necessary post-translational modification machinery. Based on the search results, several expression strategies can be employed:

  • Episomal Plasmid Expression: Using vectors containing the GAL1/10 promoter for inducible expression

  • Chromosomal Integration: Integrating the recombinant genes into yeast chromosomes, enabling growth in non-selectable rich media

  • PiggyBac Transposon Technology: For stable production, as noted in comparative transcriptomic analyses of CHO cell lines

For expression in S. cerevisiae specifically, you can use strains such as KM71H (MutS), X33 (Mut+), or SMD1168H (Mut+, Protease A deficient) .

How can I enhance the secretion and yield of recombinant ECM12 in yeast expression systems?

Several engineering strategies can significantly improve protein secretion in S. cerevisiae:

  • Engineering vesicle trafficking: Over-expression of SM protein encoding genes SEC1 and SLY1 improves protein secretion in S. cerevisiae

  • Targeting specific trafficking pathways:

    • Engineering Sec1p (SM protein involved in vesicle trafficking from Golgi to cell membrane) improves secretion of heterologous proteins and endogenous proteins

    • Enhancing Sly1p (SM protein regulating vesicle fusion from ER to Golgi) increases specific protein production

  • Optimal culture conditions:

    • Use buffered media (BMGY/BMMY)

    • Lower incubation temperature (20°C) during expression phase

    • Regular methanol feeding for AOX1 promoter-based systems

    • Addition of protease inhibitors (PMSF, EDTA) during harvesting

What are the recommended protein enrichment and solubilization methods for ECM12?

ECM proteins present unique challenges for purification due to their insolubility. Based on methodologies outlined for ECM proteins:

  • ECM Protein Enrichment:

    • Decellularization methods that take advantage of ECM proteins' insolubility

    • Extraction of more soluble intracellular proteins first

  • ECM Protein Solubilization:

    • Treatment of crude ECM-enriched samples with denaturing agents, reduction and alkylation, deglycosylation, and digestion with proteases (LysC and trypsin)

    • Avoid centrifugation during processing to minimize losses of insoluble materials

    • Solubilization occurs concomitantly with protease treatment

For recombinant ECM12 specifically, affinity purification using a His-tag is feasible, as indicated by the availability of His-tagged recombinant ECM12 protein .

How can I determine the role of ECM12 in extracellular matrix organization?

To investigate ECM12's role in ECM organization, several experimental approaches can be employed:

  • Comparative Proteomic Analysis:

    • Compare ECM composition between wild-type and ECM12 deletion strains

    • Apply methods described in "Defining the extracellular matrix using proteomics"

    • Use matrisome lists to interrogate proteomics databases for tissue-specific expression patterns

  • Microscopy-Based Approaches:

    • Fluorescent tagging of ECM12 to visualize its localization

    • Electron microscopy to examine cell wall ultrastructure in deletion mutants

  • Functional Assays:

    • Cell wall integrity tests using stressors like Congo Red or Calcofluor White

    • Osmotic stress sensitivity assays

What experimental approaches can reveal ECM12's potential interactions with other proteins?

To identify protein interaction partners of ECM12:

  • Co-immunoprecipitation followed by mass spectrometry

  • Yeast two-hybrid screening

  • Protein cross-linking coupled with MS analysis

  • ECM isolation techniques followed by interaction studies:

    • "The insolubility of ECM proteins is a challenge for subsequent proteomic analyses; indeed mass-spectrometry pipelines require proteins to be solubilized and then digested into peptides"

    • Special solubilization protocols should be employed to maintain protein interactions

  • Yeast Surface Display Selection Protocol:

    • As described in "Camping in the backyard: Identifying extracellular matrix targeting ligands using yeast surface display"

    • This involves "A typical yeast surface display selection protocol coupled with an ELISA-based screening assay, in series, to identify VLRs that preferentially accumulate in tissues"

How can I apply transcriptomic analysis to study ECM12 expression under different conditions?

To conduct transcriptomic analysis of ECM12:

  • RNA-Seq methodology:

    • Sample cells at different growth phases (e.g., exponential and stationary)

    • Use DESeq2 for differential expression analysis, as described in CHO cell transcriptomic analysis

    • Apply NB GLM model using the glm package in R for correlation analysis

  • Data analysis pipeline:

    • Filter lowly expressed genes (counts < 10)

    • Apply Benjamin-Hochberg multiple testing correction

    • Identify genes with significant correlation to productivity (padj <= 0.05)

    • Focus on genes with strong correlation coefficients (|R| > 0.5)

  • Functional module analysis:

    • Curate genes into relevant functional modules using KEGG pathway, KEGG BRITE, and Gene Ontology databases

    • Compare expression patterns with related pathways such as "Protein synthesis, ER entry/translocation, ER chaperones, UPR, ER exit"

What role might ECM12 play in extracellular vesicle (EV) biology in yeast?

Recent research has highlighted the importance of extracellular vesicles in yeast biology. To investigate ECM12's potential role:

What approaches can be used to study post-translational modifications of ECM12?

Post-translational modifications (PTMs) can significantly impact ECM12 function. To characterize PTMs:

  • Expression system selection:

    • "Proteins expressed in the yeast system provide eukaryotic post-translational modifications, making it superior to bacterial expression for factors that require post-translational modification"

    • S. cerevisiae is more suitable than E. coli for producing glycosylated proteins: "Saccharomyces cerevisiae is the best source of recombinant interferon than E-coli Since E-coli does not possess the machinery for glycolysation of protein"

  • Protein Disulfide Isomerase (PDI) co-expression:

    • "PDI-co-expression-in-P. pastoris strategy" can improve correct folding of disulfide-rich proteins

    • For ECM12, which may contain disulfide bonds, this approach could significantly improve functional expression

  • Glycosylation analysis:

    • Treat purified protein with Endo Hf to prune back high-mannose N-glycans

    • Analyze glycosylation patterns using specialized glycoproteomics approaches

How can I address challenges in detecting low-abundance ECM12 protein?

ECM proteins can be challenging to detect due to their often low abundance and difficult extraction properties:

  • Enrichment strategies:

    • Consider using heparin-affinity resin for enrichment before detection

    • "To obtain WB-detectable gel bands, we first had to enrich mFH on heparin-affinity resin"

  • Detection protocols:

    • Use SDS-PAGE under both reducing and non-reducing conditions to detect differences in migration patterns due to disulfide bonds

    • Verify identity using Western blotting with specific antibodies

    • For extremely low abundance, consider more sensitive detection methods like immunofluorescence or MS-based targeted proteomics

What genetic manipulation approaches can I use to study ECM12 function in vivo?

To investigate ECM12 function through genetic manipulation:

  • Transformation methods for S. cerevisiae:

    • Electroporation of competent cells with linearized DNA

    • "Immediately after electroporation, add ice-cold 1 M sorbitol or yeast-peptone-dextrose-sorbitol (YPDS) medium and incubate at 30°C for three hours"

    • Plate on appropriate selective media containing antibiotics like zeocin (100-500 μg/mL)

  • Gene knockout strategies:

    • CRISPR-Cas9 system for precise gene editing

    • Homologous recombination-based gene replacement

    • Analysis of phenotypic effects on growth, stress responses, and cell wall integrity

  • Overexpression studies:

    • Use of strong inducible promoters like GAL1/10

    • Integration of multiple gene copies for increased expression

    • Assessment of effects on secretion, cell wall structure, and stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.