Recombinant Saccharomyces cerevisiae Protein ECM34 (ECM34)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECM34; YHL043W; Protein ECM34; Extracellular mutant protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-170
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ECM34
Target Protein Sequence
MEGRKSEDEKNEAALACDVFESSNAKLPKNVFRSSFTWYCYEVINRSAFHIWLLLCLTLI VGWKVFSGIGGRRPSDSNMDGPQTKHKRNPGFLRRHSTIVILVISLAVSFSWEAFKMYRE RTFGKQITQFAKEIIKSAPSTDMESWDRVAADFNSYMYENKLWNTEYFFC
Uniprot No.

Target Background

Function
Potentially involved in cell wall organization and biogenesis.
Database Links

KEGG: sce:YHL043W

STRING: 4932.YHL043W

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ECM34 and what is its genomic location in Saccharomyces cerevisiae?

ECM34 is a gene located on chromosome VIII of Saccharomyces cerevisiae. While its precise function remains largely unknown, it has gained significant attention in yeast genetics research due to its involvement in adaptive chromosomal rearrangements . The gene contains a promoter region that, in certain yeast strains (particularly those isolated from wine), has been found to undergo recombination with the promoter of another gene, SSU1, located on chromosome XVI .

Experimental approach for chromosomal location confirmation:

  • Pulse-field gel electrophoresis (PFGE) to separate chromosomes

  • Southern blotting with ECM34-specific probes

  • PCR-based methods using chromosome VIII-specific primers

What sequence characteristics define the ECM34 promoter region?

Methodology for promoter analysis:

  • PCR amplification using primers ECM34D and ECM34R yields a 207-bp fragment corresponding to the standard ECM34 locus

  • Sequencing of this region allows identification of specific polymorphisms

  • Comparative sequence analysis across strains helps identify conserved motifs

How should researchers design experiments to efficiently study ECM34 function?

When investigating a gene with unknown function like ECM34, a systematic experimental design approach using statistical methods is recommended. Response Surface Methodology (RSM) provides an effective framework for experimental planning that maximizes information content while minimizing the number of experiments needed .

Implementation methodology:

  • Begin with screening experiments to identify which factors significantly influence ECM34 expression or function

  • Utilize fractional factorial designs to reduce the number of experimental runs while still capturing important effects

  • Apply central composite designs (CCDs) for more detailed investigation of identified factors

  • Employ sequential experimentation to iteratively refine the experimental space and generate increasingly accurate models around the suspected optimum

Design TypeNumber of FactorsNumber of LevelsAdvantagesBest Used For
Full Factorialk2-3Complete informationSmall number of factors
Fractional Factorialk2-3Reduced experimentsInitial screening
Central Compositek5Estimation of quadratic effectsResponse optimization
Face-Centered (CCF)k3Constrains experimental spaceRealistic parameter ranges

What PCR-based methods are recommended for analyzing ECM34 and its recombination variants?

For effective PCR-based analysis of ECM34 and its recombination variants with SSU1, researchers should design specific primers that target both the non-recombinant and recombinant forms:

  • For non-recombinant ECM34 promoter: Use primer combinations that amplify the native ECM34 promoter region (e.g., ECM34D+ECM34R)

  • For recombinant forms: Design primers that span the junction points of recombination

    • SSU1MD+ECM34R primer pair will yield a ~450-bp band in strains with the translocation

    • This represents the recombinant form where the ECM34 promoter has recombined with the SSU1 coding region

For comprehensive strain characterization, researchers should analyze multiple strains from diverse sources (wine and non-wine environments) to establish the frequency and distribution of recombination events .

How does the chromosomal rearrangement between ECM34 and SSU1 affect yeast phenotype and adaptive evolution?

The translocation between chromosomes VIII and XVI, involving ECM34 and SSU1 promoter regions, represents a significant example of adaptive evolution in Saccharomyces cerevisiae wine strains . This rearrangement is mediated by crossing-over between microhomology regions in the respective gene promoters .

Methodological approach to study this phenomenon:

  • Comparative genomic analysis of translocation-positive and translocation-negative strains

  • Phenotypic characterization under wine fermentation conditions

  • Experimental evolution studies to trace the emergence of the translocation

  • Functional analysis of the recombinant SSU1-R allele versus the normal SSU1

Research findings indicate that this translocation has been identified in multiple wine yeast strains from different geographical areas, suggesting it provides an adaptive advantage in wine fermentation environments . The translocation appears to be a rare, unique evolutionary event, as sequence analysis of the recombinant SSU1-R promoters from different strains showed they were all identical except for the number of 76-bp repeats .

What statistical approaches should be used for analyzing complex ECM34 expression data?

When analyzing complex data from ECM34 experiments, particularly in bioprocess optimization contexts, several statistical approaches are recommended:

  • Principal Components Analysis (PCA): For visualizing similarities between expression profiles and reducing dimensionality of complex datasets

  • Empirical Bayes moderated t-statistics: For estimating changes in expression over replicates, as implemented in LIMMA (Linear Models for Microarray Data)

  • False Discovery Rate (FDR) control: Apply Benjamini-Hochberg method to control for multiple testing when analyzing differential expression

  • Normalization methods: Background correction using normexp method with appropriate offset, followed by Log2-transformation and quantile normalization

Researchers should employ specialized software tools such as:

How can researchers effectively isolate and characterize recombinant ECM34 protein?

For the isolation and characterization of recombinant ECM34 protein, researchers can apply similar approaches used for other yeast proteins, with specific adaptations:

  • Expression system selection:

    • Chinese Hamster Ovary (CHO) cells have been successfully used for expressing other recombinant proteins with high purity (>95%)

    • Alternatively, consider E. coli or yeast expression systems depending on research goals

  • Purification strategy:

    • Affinity chromatography using epitope tags (His, GST, FLAG)

    • Size exclusion chromatography

    • Ion-exchange chromatography

  • Characterization methods:

    • SDS-PAGE and HPLC for purity assessment

    • Mass spectrometry for protein identification

    • Western blotting for expression verification

    • Glycosylation analysis if post-translational modifications are suspected

  • Functional assays:

    • Based on hypothesized function from sequence homology or structural predictions

    • Protein-protein interaction studies (pull-down assays, co-immunoprecipitation)

    • Cell-based functional assays

What are the recommended approaches for studying ECM34 promoter variants across yeast strains?

When investigating ECM34 promoter variants across different yeast strains, researchers should implement a systematic approach:

  • Strain collection and characterization:

    • Include strains from diverse sources (wine and non-wine) and geographic origins

    • Document strain history and isolation data

  • PCR amplification and sequencing:

    • Design primers flanking the entire promoter region

    • Use high-fidelity DNA polymerases to minimize sequencing errors

    • Consider both direct sequencing and cloning approaches for heterozygous strains

  • Sequence analysis:

    • Multiple sequence alignment to identify polymorphisms and repeat variations

    • Phylogenetic analysis to establish evolutionary relationships

    • Motif identification for potential regulatory elements

  • Functional characterization:

    • Reporter gene assays to assess promoter strength of different variants

    • Analysis of expression levels under various conditions

    • Chromatin immunoprecipitation to identify transcription factor binding

Research findings show that sequence analysis of ECM34 promoters from 23 S. cerevisiae strains and 8 strains from other Saccharomyces "sensu stricto" species revealed seven distinct sequence variants (A-G) , providing valuable information about the evolutionary history of this gene.

How can researchers address the unknown function of ECM34?

Given that ECM34 is described as "a gene of unknown function" , several complementary approaches can be employed to elucidate its biological role:

  • Computational approaches:

    • Sequence homology analysis across species

    • Structural prediction of the encoded protein

    • Gene ontology and pathway enrichment analysis

  • Genetic approaches:

    • Gene deletion/knockout studies to assess phenotypic effects

    • Overexpression studies to identify gain-of-function phenotypes

    • Synthetic genetic array analysis to identify genetic interactions

  • Expression analysis:

    • Transcriptomic profiling under various conditions

    • Proteomics to study protein expression and interactions

    • Localization studies using tagged versions of the protein

  • Evolutionary analysis:

    • Comparative genomics across Saccharomyces species

    • Analysis of selection pressure on the ECM34 coding sequence

    • Investigation of ECM34 presence/absence in relation to ecological niches

What research directions might explain the relationship between ECM34 and SSU1 recombination?

The documented recombination between ECM34 and SSU1 promoters raises several intriguing research questions that could be addressed through:

  • Structural genomics:

    • Analysis of chromatin architecture in the regions containing ECM34 and SSU1

    • Investigation of physical proximity of chromosomes VIII and XVI during cell cycle

    • Study of DNA sequence elements that might facilitate recombination

  • Functional consequences:

    • Comparative analysis of sulfite resistance (SSU1 function) in strains with different ECM34-SSU1 arrangements

    • Investigation of transcriptional changes resulting from the rearrangement

    • Analysis of fitness effects in different environmental conditions

  • Evolutionary dynamics:

    • Survey of natural populations to determine frequency of the rearrangement

    • Experimental evolution studies to trace emergence of the translocation

    • Mathematical modeling of selection dynamics

Current research indicates that the ECM34-SSU1 translocation appears to be a unique evolutionary event that occurred in wine yeast strains, suggesting an adaptive advantage in wine-making environments . The translocation involves a reciprocal exchange between chromosomes VIII and XVI at the 5′ upstream regions of the SSU1 and ECM34 genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.