Recombinant Saccharomyces cerevisiae Protein ECM7 (ECM7)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Saccharomyces cerevisiae Protein ECM7 (ECM7)

Recombinant Saccharomyces cerevisiae Protein ECM7 (ECM7) is a recombinant protein derived from the yeast Saccharomyces cerevisiae, produced via heterologous expression systems. It corresponds to the native ECM7 protein, a homolog of the γ subunits of animal voltage-gated calcium channels (VGCCs). ECM7 plays a critical role in regulating calcium influx through the Cch1/Mid1 high-affinity calcium uptake system (HACS), particularly under low-calcium conditions or calcineurin-deficient states .

Biological Roles and Regulation

ECM7 modulates calcium signaling in S. cerevisiae through interactions with the Cch1/Mid1 channel and cortical ER membrane proteins like Scs2. Key findings include:

Calcium Channel Regulation

  • Positive Regulation in Calcineurin-Deficient Cells: Deletion of ECM7 reduces α-factor-induced Ca²⁺ accumulation by ~75% in cnb1Δ (calcineurin-deficient) mutants .

  • Dependence on Phosphorylation Status: ECM7 activates a phosphorylated form of HACS or its regulators when calcineurin is inactive .

Interaction with Scs2

  • Dual Regulation: Scs2 (a cortical ER protein) negatively regulates HACS in calcineurin-functional cells, but this repression is canceled by ECM7 deletion .

  • ER-Plasma Membrane Crosstalk: Scs2 may transduce ER stress signals to the Cch1/Mid1 channel via ECM7 .

Genetic Studies

StrainCa²⁺ AccumulationViability
Wild-typeBaselineNormal
ecm7ΔSlight reduction (~17%)Unaffected
cnb1Δ7.4× increaseReduced
cnb1Δ ecm7ΔReverts to wild-type levelsFurther reduced viability

Data derived from α-factor-treated cells in low-Ca²⁺ medium .

Recombinant Production and Applications

Recombinant ECM7 is produced in E. coli or other systems, with varying tags (e.g., His-tag) for purification. Key production parameters and applications include:

ParameterDetails
Expression HostE. coli (most common), yeast, or baculovirus systems
Purity>85% (SDS-PAGE validated)
StorageLyophilized: 12 months at -20°C/-80°C; Liquid: 6 months at -20°C/-80°C
ApplicationsELISA, Western blot, SDS-PAGE, functional assays

Truncation Analysis

  • C-Terminal Truncations: Ecm7 1-322 and Ecm7 1-412 retain ~25% activity, indicating the C-terminal region (aa 413–428) is partially required .

  • Phosphorylation-Deficient Mutants: Deletion of Ser 429–432 or Ser 435 does not impair function, suggesting phosphorylation is non-essential under tested conditions .

Functional Interactions

  • Cch1 Binding: ECM7 directly interacts with Cch1, as shown via split-ubiquitin yeast two-hybrid assays .

  • ER Stress Response: ECM7 may mediate calcium influx during ER stress via Scs2-mediated signaling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment based on your requirements.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ECM7; ZRG15; YLR443W; Protein ECM7; Extracellular mutant protein 7; Zinc-regulated gene 15 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ECM7
Target Protein Sequence
MVMSRIRDTIARPFQNLTALEKVVQWLRLGTTLLIISFGLALTVGPLSSPRTLYMSRLDT YSADITTGLFTVLRESMEQSTSTEENNGVGLTTSELYILTAYTESQIKNVPQYITVSLYG RCDSTYTMVEVFDSEGNMHSVKNSTTKSTCSSIGTDYLFDYREVLESLGLDIILDYAYNK IGSQQAESSAYTTYMRSLKHKKANVLHLLYAVISFQVCMLFFMIWYYYIKGRFMNALKER ALVHINSLLSLVVFIGGLISSISLAWVNYTIQSRINTELEAFGFSYHLGVTWFALLWCFA GLISVSCLAWSGLEWCISDNGTSYGGGIDDKFLGYQAGVFTDADLDDETSYSQRYPQRQS TSGEAELMRNSDTMATIRKTSDVDLNSENDANTSLDHGNPTANISNGGKHEPFATREEFE LQDIRFRSSNDSEESMQRVIKPSSALQF
Uniprot No.

Target Background

Function
Potentially involved in cell wall organization and biogenesis.
Gene References Into Functions
  1. Deletion of SCS2 did not affect Ca2+ influx when calcineurin was inhibited by FK506, but increased this activity by 35% in the absence of inhibition. However, this increase was abolished by deletion of ECM7. This suggests that Cch1/Mid1 regulation by Ecm7 and Scs2 is differentially affected by Cch1 phosphorylation status. PMID: 28742147
Database Links

KEGG: sce:YLR443W

STRING: 4932.YLR443W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ECM7 protein and what are its basic characteristics?

ECM7 is a protein found in Saccharomyces cerevisiae (baker's yeast) that functions as a positive regulator of high-affinity calcium uptake system (HACS). It is a yeast homolog of animal voltage-gated calcium channel (VGCC) γ subunits. The protein contains seven phosphorylation sites in its intracellular C-terminal region and appears to selectively activate phosphorylated forms of HACS or its regulators .

When working with recombinant ECM7, researchers typically use the strain ATCC 204508/S288c as the source organism. The protein has a UniProt identifier of Q06200 and can be accessed through various research-grade reagents such as antibodies for experimental detection .

How does ECM7 protein function in Saccharomyces cerevisiae?

Research has demonstrated that in calcineurin-deficient cells exposed to α-factor (a yeast mating pheromone), calcium accumulation was 7.4-fold higher than in wild-type cells. When ECM7 was deleted in this calcineurin-deficient background, calcium accumulation decreased to approximately one-fourth of the level observed in the calcineurin-deficient strain alone .

What detection methods are available for studying ECM7?

Several methodological approaches are available for studying ECM7 in laboratory settings:

  • Antibody-based detection: Polyclonal antibodies against recombinant ECM7 are available for techniques such as Western blotting (WB) and ELISA. These antibodies are typically raised in rabbits against the recombinant protein and purified using antigen affinity methods .

  • Genetic approaches: The function of ECM7 can be studied using deletion mutants (ecm7Δ) and comparing phenotypes with wild-type strains. Epistasis analysis can be performed by creating double mutants (e.g., ecm7Δ cch1Δ or ecm7Δ cnb1Δ) to understand functional relationships .

  • Calcium accumulation assays: The functional role of ECM7 can be quantitatively assessed using radioactive calcium (45Ca2+) accumulation assays in various genetic backgrounds and under different treatment conditions .

  • Fluorescence microscopy: Fusion proteins like Cch1-EGFP can be used to visualize the localization and potential co-localization of ECM7 with its interacting partners .

How does the phosphorylation state affect ECM7 function in calcium channel regulation?

The relationship between ECM7 phosphorylation and calcium channel regulation is complex and depends on cellular context. ECM7 contains seven phosphorylation sites in its C-terminal region, but experimental evidence suggests these sites are not essential for the core function of ECM7 in activating calcium uptake .

When researchers constructed truncated versions of ECM7 lacking all seven phosphorylation sites (Ecm7 1-322) or lacking three C-terminal phosphorylation sites (Ecm7 1-412), these mutant proteins still retained approximately 25% of the wild-type ECM7 activity. Further experiments with deletion mutants revealed that the region between amino acid residues 413 and 428 appears important for ECM7 activity, though its contribution is partial .

This indicates that while the phosphorylation sites themselves may not be critical, ECM7 likely functions by interacting with phosphorylated forms of other components in the calcium uptake system. The evidence suggests that ECM7 selectively activates phosphorylated forms of HACS or its regulators, rather than requiring phosphorylation itself for activation .

What is the relationship between ECM7 and calcineurin in regulating calcium homeostasis?

The relationship between ECM7 and calcineurin represents a sophisticated regulatory mechanism for calcium homeostasis in yeast. Experimental data demonstrates that these components have an inverse relationship:

  • In wild-type cells with functional calcineurin: ECM7 plays a minimal role in calcium uptake. When researchers deleted ECM7 in this background, calcium accumulation was only slightly reduced (by approximately 17%) compared to wild-type cells .

  • In calcineurin-deficient cells (cnb1Δ): ECM7 becomes critically important. Calcium accumulation in cnb1Δ mutants exposed to α-factor was 7.4-fold higher than in wild-type cells. When ECM7 was additionally deleted in this background, calcium accumulation decreased dramatically to about 25% of the level seen in cnb1Δ single mutants .

This relationship suggests a regulatory circuit where calcineurin normally dephosphorylates components of the calcium uptake system, keeping calcium influx moderate. When calcineurin is absent, these components remain phosphorylated, and ECM7 strongly promotes their activity, leading to elevated calcium uptake. This mechanism provides insights into how yeast cells maintain calcium homeostasis under different physiological conditions .

How do truncated forms of ECM7 affect its functionality in experimental systems?

Truncation experiments have provided valuable insights into the functional domains of ECM7. Researchers have tested several truncated forms of ECM7 to determine which regions are essential for its activity:

ECM7 VariantDescriptionRelative Ca2+ Accumulation ActivityFunctional Implication
Wild-type ECM7Full-length protein100%Complete functionality
Ecm7 1-322Lacking all seven phosphorylation sites~25%Partial functionality despite missing all phosphorylation sites
Ecm7 1-412Lacking three C-terminal phosphorylation sites~25%Partial functionality despite missing some phosphorylation sites
Ecm7 ΔS429-S432Deletion of region containing two phosphorylation sites~100%Normal functionality despite missing key phosphorylation sites
Ecm7 1-432Deletion of C-terminal region from Glu 433 to the C-terminus~100%Normal functionality despite C-terminal truncation

What are the optimal protocols for expressing and purifying recombinant ECM7?

For expressing and purifying recombinant ECM7 from Saccharomyces cerevisiae, researchers should consider the following methodological approach:

  • Expression system selection: The strain ATCC 204508/S288c (Baker's yeast) is the standard source for ECM7. This strain provides consistent expression of native ECM7 protein with proper post-translational modifications .

  • Purification strategy: Antigen affinity purification has proven effective for isolating ECM7 protein. This approach utilizes specific antibodies against ECM7 immobilized on a solid support to capture the protein of interest from cell lysates .

  • Storage conditions: Once purified, ECM7 protein should be stored at -20°C or -80°C in a buffer containing 50% glycerol and 0.01M PBS (pH 7.4) with 0.03% Proclin 300 as a preservative. It's important to avoid repeated freeze-thaw cycles as these can degrade protein quality .

  • Quality control: Expression and purification success should be verified through Western blotting using specific antibodies against ECM7, with appropriate positive and negative controls to ensure specificity .

How can researchers effectively design experiments to study ECM7 function in calcium regulation?

When designing experiments to investigate ECM7's role in calcium regulation, researchers should consider the following methodological framework:

  • Genetic manipulation approach:

    • Create single and double deletion mutants (ecm7Δ, cch1Δ, cnb1Δ, ecm7Δ cch1Δ, ecm7Δ cnb1Δ)

    • Develop complementation systems using plasmids expressing wild-type or mutant ECM7 variants

    • Consider using temperature-sensitive alleles for conditional studies

  • Calcium measurement techniques:

    • Utilize 45Ca2+ radioactive tracer accumulation assays under various conditions, particularly in low calcium medium (e.g., SD.Ca100 containing 100 μM CaCl2)

    • Employ calcium-sensitive fluorescent dyes for real-time calcium flux measurements

    • Consider electrophysiological approaches for direct channel activity measurement

  • Experimental conditions:

    • Induce HACS activity using α-factor treatment (typically 2 hours for Ca2+ accumulation assays and 8 hours for viability assays)

    • Compare results in normal and low calcium media

    • Test under conditions with functional or inhibited calcineurin (using cnb1Δ mutants or FK506 treatment)

  • Control experiments:

    • Include wild-type strains as positive controls

    • Use known channel mutants (cch1Δ) as negative controls

    • Verify protein expression levels via Western blotting to ensure phenotypes aren't due to protein instability

What are the critical considerations when using ECM7 antibodies in experimental applications?

When utilizing antibodies against ECM7 for experimental applications, researchers should consider several critical factors:

  • Antibody specificity validation:

    • Perform Western blot analysis using wild-type and ecm7Δ mutant strains to confirm specificity

    • Consider pre-absorption controls with purified antigen to verify specific binding

    • Include multiple antibody clones when possible to confirm results through independent detection

  • Application-specific optimizations:

    • For Western blotting: Determine optimal sample preparation methods, loading amounts, and blocking conditions

    • For ELISA: Establish appropriate coating concentrations, incubation times, and detection systems

    • For immunofluorescence: Validate fixation methods that preserve ECM7 epitopes while maintaining cellular architecture

  • Technical specifications:

    • Use antibodies raised in rabbit against recombinant ECM7 from strain ATCC 204508/S288c

    • Store antibodies in liquid form with 50% glycerol, 0.01M PBS (pH 7.4), and 0.03% Proclin 300

    • Maintain at -20°C or -80°C and avoid repeated freeze-thaw cycles

  • Control considerations:

    • Include appropriate isotype controls (e.g., rabbit IgG) to assess non-specific binding

    • Use known positive samples to verify detection sensitivity

    • Consider protein loading controls for quantitative applications

How does ECM7 interact with other components of the calcium channel complex?

ECM7 functions within a complex network of protein interactions that regulate calcium influx in yeast cells. Based on experimental evidence, several key interactions have been identified:

  • Interaction with Cch1: While direct binding has not been definitively proven in the provided research, ECM7 is suggested to regulate the Cch1 calcium channel component. This is inferred from the observation that ECM7 function is completely dependent on the presence of Cch1, as demonstrated by the ecm7Δ cch1Δ double mutant showing identical calcium accumulation to the cch1Δ single mutant .

  • Relationship with Mid1: The research indicates that ECM7 likely does not directly interact with Mid1 (another component of the calcium channel complex) because the entire Mid1 molecule is localized extracellularly. This suggests that ECM7's regulatory effects are primarily directed toward Cch1 or other intracellular components .

  • Regulation by phosphorylation state: ECM7 appears to selectively regulate phosphorylated forms of the calcium channel complex, particularly when calcineurin (which would normally dephosphorylate these components) is absent. This provides a sophisticated regulatory mechanism that modulates calcium channel activity based on the phosphorylation state of the system .

  • Potential interaction with Scs2: The research mentions Scs2 as a new Cch1-binding protein that, together with ECM7, differentially regulates calcium channels. While ECM7 acts as a positive regulator, Scs2 appears to function as a negative regulator, suggesting a balanced control system .

What are the implications of ECM7 research for understanding calcium signaling in higher eukaryotes?

Research on ECM7 in yeast provides valuable insights that may have broader implications for calcium signaling in higher eukaryotes:

  • Evolutionary conservation of calcium channel regulation: ECM7 is a yeast homolog of animal voltage-gated calcium channel (VGCC) γ subunits. Understanding how ECM7 regulates calcium channels in yeast may provide evolutionary insights into similar regulatory mechanisms in more complex organisms .

  • Phosphorylation-dependent regulatory mechanisms: The research on ECM7 reveals sophisticated phosphorylation-dependent regulatory mechanisms for calcium channels. Similar principles of calcium channel regulation through phosphorylation/dephosphorylation cycles likely exist in higher eukaryotes, potentially involving homologous proteins .

  • Calcineurin-dependent calcium homeostasis: The inverse relationship between calcineurin activity and ECM7 function in yeast suggests a feedback regulation system for calcium homeostasis. Similar regulatory circuits involving calcineurin are known to exist in mammalian cells, suggesting conserved homeostatic mechanisms .

  • Stress-responsive calcium signaling: The research mentions that ECM7 is involved in calcium signaling under specific stress conditions (e.g., α-factor exposure, low calcium). Understanding these pathways in yeast may inform investigations of stress-responsive calcium signaling in more complex systems .

What are the promising areas for future investigation of ECM7 structure-function relationships?

Based on current understanding, several promising research directions could advance knowledge of ECM7 structure-function relationships:

  • Detailed structural characterization: X-ray crystallography or cryo-electron microscopy studies of ECM7 alone and in complex with Cch1 would provide valuable insights into how these proteins interact at the molecular level.

  • Comprehensive mutagenesis analysis: While truncation experiments have identified important regions, systematic site-directed mutagenesis of conserved residues could pinpoint specific amino acids critical for ECM7 function.

  • Investigation of the 413-428 region: Research has identified this region as important for ECM7 activity. Detailed analysis of this segment through mutagenesis, structural studies, and interaction assays could reveal its specific functional role.

  • Comparative analysis with mammalian VGCC γ subunits: Cross-species complementation experiments and structural comparisons between ECM7 and mammalian VGCC γ subunits could identify conserved functional domains and evolutionary relationships .

  • Development of computational models: Integration of experimental data into computational models of ECM7 structure and function could guide hypothesis generation and experimental design for further studies.

How can advanced technologies be applied to deepen our understanding of ECM7 regulatory networks?

Emerging technologies offer new opportunities to advance ECM7 research:

  • CRISPR-Cas9 genome editing: This technology enables precise genetic manipulation to create subtle mutations in ECM7 or related genes, allowing more nuanced functional studies than traditional knockout approaches.

  • Proximity labeling proteomics: Techniques like BioID or APEX could identify proteins that physically interact with ECM7 in living cells, providing a comprehensive map of its interaction network.

  • Single-cell analysis: Single-cell transcriptomics and proteomics could reveal cell-to-cell variability in ECM7 expression and function, potentially uncovering new regulatory mechanisms.

  • Live-cell calcium imaging: Advanced calcium indicators and high-resolution microscopy could provide real-time visualization of calcium dynamics in relation to ECM7 activity under various conditions.

  • Systems biology approaches: Integration of multiple data types (genomics, proteomics, metabolomics) could position ECM7 within broader cellular networks and reveal unexpected functional connections .

What are the potential biotechnological applications of ECM7 research?

ECM7 research may lead to several biotechnological applications:

  • Yeast strain engineering: Modified ECM7 could be used to engineer yeast strains with altered calcium homeostasis for specific biotechnological processes that depend on calcium signaling.

  • Drug discovery platforms: Understanding ECM7's role in calcium channel regulation could inform the development of screening platforms for compounds that modulate calcium channel activity.

  • Biosensor development: ECM7-based biosensors could be developed to monitor calcium channel activity or detect compounds that affect calcium signaling in high-throughput screening applications.

  • Model systems for human disease: Given that calcium channel dysfunction is implicated in various human diseases, ECM7 studies in yeast could provide valuable model systems for understanding disease mechanisms and testing therapeutic approaches.

  • Protein engineering applications: Insights from ECM7 structure-function studies could inform the engineering of proteins with custom calcium-regulatory properties for research or biotechnological applications .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.