Recombinant Saccharomyces cerevisiae Protein ERD1 (ERD1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Biology

ERD1 is pivotal in two primary biological processes:

ER Retention and Protein Quality Control

ERD1 ensures the retention of luminal ER proteins via the HDEL (His-Asp-Glu-Leu) signal . In erd1Δ mutants:

  • BiP secretion: Endogenous ER chaperones like BiP are secreted at rates equivalent to HDEL-deleted variants in wild-type cells .

  • HDEL-invertase loss: Failure to retain invertase fusion proteins bearing the HDEL signal .

Golgi Enzyme Recycling and Glycosylation

ERD1 interacts with cytosolic receptor Vps74 and the COG complex to recycle early Golgi glycosyltransferases via COPI vesicles :

  • Chaperoning: Stabilizes Golgi enzymes (e.g., Kre2) during trafficking.

  • Genetic Suppression: Overexpression of COG subunits (Cog5, Cog7) or Gyp1 (a Ypt1 GAP) rescues erd1Δ defects .

Wild-Type ERD1erd1Δ Mutant
Efficient HDEL retentionPremature secretion of ER proteins
Normal glycosylationDefective glycoprotein processing
Stable enzyme recyclingLoss of Golgi glycosyltransferases

Biotechnological Applications

ERD1’s role in ER stress management makes it a target for optimizing recombinant protein production in yeast:

  • ER Stress Mitigation: Overexpression of ERD1-related chaperones (e.g., Kar2p) enhances folding capacity .

  • Anaerobic Production: ERD1 may influence redox balance, as reactive oxygen species (ROS) accumulate during protein folding under anaerobic conditions .

Recombinant ERD1 in Research

  • SDS-PAGE: Used to validate protein expression and purity .

  • Functional Assays: Studies on ER retention mechanisms and Golgi trafficking .

Interaction with Vps74 and COPI Vesicles

ERD1 forms a transmembrane-cytosolic complex with Vps74 to anchor glycosyltransferases during COPI-mediated recycling :

  1. Stabilization: ERD1 prevents aggregation of enzymes like Kre2.

  2. Trafficking: Required for COPI vesicle formation and tethering via COG/GARP complexes.

Genetic and Metabolic Links

  • Genetic Networks: ERD1’s profile overlaps with glycosylation and transport genes in genome-wide screens .

  • Ion Homeostasis: erd1Δ mutants exhibit phosphate (Pi) leakage, though this is distinct from glycosylation defects .

Critical Considerations in Experimental Use

  • Storage: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Reconstitution: Use sterile water or buffer with 5%–50% glycerol for long-term storage .

  • Functional Validation: Confirm activity via assays targeting ER retention or Golgi enzyme recycling .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ERD1; YDR414C; D9461.4; Protein ERD1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-362
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ERD1
Target Protein Sequence
MEKSESNSEGLYLQNILNVPPPQRFIVLIILALWIWTWILKFFLHSNLDVSQVILTRVPH DIRPGYTLQQLHRTARNFALKITRIIIPFHFATVFLFEFMNIIEGPLKNIILIVYFLPLI QCVTIFWFLLKECQIIKYCTRRCLLIESSPRSLRNTYILISDTLTSFAKPLIDFTLFTSL IFREPFTHFDLSVALLPVLVRLLQCLREYRLLHEATLLFNALKYSCNLPILFCTWRSRVY EGSINEERLHHVQRWFMLINSSYTLFWDVRMDWSLDSLTSLRSRSKSAVTLKKKMYHSAI LVDFLLRFWWLWVYLSQNLKLVAADSDYIFFQGEMQYFEVIRRGIWVVFKLDAEYYIKFA SK
Uniprot No.

Target Background

Function
ERD1 is essential for retaining luminal endoplasmic reticulum proteins and influences glycoprotein processing within the Golgi apparatus.
Gene References Into Functions
  1. Erd1 transports Pi in the opposite direction compared to XPR1 and other EXS family proteins, facilitating byproduct removal from the Golgi complex in conjunction with Gdt1. PMID: 29042410
Database Links

KEGG: sce:YDR414C

STRING: 4932.YDR414C

Protein Families
ERD1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ERD1 and what is its primary function in Saccharomyces cerevisiae?

ERD1 is a yeast gene that encodes a membrane protein essential for the retention of luminal endoplasmic reticulum (ER) proteins in Saccharomyces cerevisiae. The primary function of ERD1 is to facilitate proper trafficking and retention of ER-resident proteins by affecting glycoprotein processing in the Golgi apparatus . Sequence analysis predicts that ERD1 encodes a membrane protein featuring multiple transmembrane domains, which is supported by studies using ERD1-SUC2 fusion proteins . As an integral part of the protein recycling machinery, ERD1 ensures productive recycling of several early Golgi enzymes back to the ER .

To study ERD1 function, researchers typically employ genetic approaches such as gene deletion or mutation, followed by analysis of phenotypic changes, particularly the secretion patterns of known ER-resident proteins. Fluorescence microscopy, subcellular fractionation, and immunoprecipitation techniques are valuable for determining ERD1 localization and interaction partners.

How does the absence of ERD1 affect ER-resident protein localization?

In cells lacking the ERD1 gene (erd1Δ mutants), there is a profound disruption of the ER protein retention system. These mutants secrete endogenous ER proteins such as BiP at rates equivalent to those observed when wild-type cells secrete modified BiP lacking the HDEL retention signal . This indicates that ERD1 plays a critical role in the H/KDEL-dependent protein retrieval system.

Methodologically, this can be measured through:

  • Western blot analysis of culture supernatants to detect secreted ER proteins

  • Pulse-chase experiments to track the fate of labeled ER proteins

  • Subcellular fractionation to determine protein localization

  • Fluorescence microscopy of tagged ER proteins to visualize localization changes

Interestingly, erd1 mutant cells do not display gross abnormalities in their intracellular membrane systems but exhibit specific defects in Golgi-dependent modification of glycoproteins, suggesting a selective role in protein trafficking rather than a general effect on membrane organization .

How does ERD1 function in relation to the H/KDEL retrieval system?

ERD1 is an essential component in the H/KDEL-dependent retrieval pathway for ER-resident proteins. Most soluble ER-resident proteins in S. cerevisiae, including BiP/Kar2p and Pdi1p, contain C-terminal H/KDEL tetrapeptide retrieval motifs (typically HDEL in yeast) . These proteins continuously shuttle between the ER and Golgi, where they are retrieved via retrograde transport machinery .

The current model suggests that ERD1 functions is required for the correct interaction of the HDEL receptor (Erd2p) with its ligands . When ERD1 is absent, this interaction is compromised, leading to secretion of ER proteins despite the presence of their retrieval signals. The specific molecular mechanism may involve:

  • Direct interaction with the H/KDEL receptor Erd2p

  • Establishment of optimal pH or ionic conditions in the Golgi for receptor-ligand binding

  • Facilitation of vesicle formation for retrograde transport

The requirement of HDEL-dependent retrieval for cell growth in budding yeast underscores the essential nature of this pathway and ERD1's role within it.

What genetic interactions inform our understanding of ERD1 function?

Dosage suppressor screens have identified several genes that, when overexpressed, can compensate for the loss of ERD1 function. These include genes involved in membrane protein trafficking (Gyp1, Cog5, Cog7, Ypt7) and those with previously reported genetic interactions with either ERD1 or Vps74 (Dcr2, Neo1, Ers1) .

This genetic interaction network provides valuable insights into ERD1 function:

Suppressor GeneFunctionRelevance to ERD1
Gyp1GTPase-activating protein for Rab GTPase Ypt1Negatively regulates Ypt1 at the cis-Golgi
Cog5, Cog7Subunits of COG complexRequired for tethering vesicles for intra-Golgi glycosyltransferase recycling
Ypt7Rab GTPaseInvolved in membrane trafficking
Dcr2, Neo1, Ers1Various functionsPrevious genetic interactions with ERD1 or Vps74

Intriguingly, the GDP-locked (inactive) mutant of Ypt1 (ypt1 S22N) partially suppresses defects in erd1 mutants, suggesting that reduction in Ypt1 function compensates for ERD1 loss . This points to a potential regulatory relationship between ERD1 and Ypt1-dependent trafficking pathways.

What are the recommended methods for recombinant expression and characterization of ERD1?

For recombinant expression and characterization of ERD1, researchers should consider the following methodological approaches:

  • Expression System Selection: While E. coli systems are commonly used for recombinant protein expression, for ERD1 and other membrane proteins, expression in the native organism (S. cerevisiae) often yields better results for maintaining proper folding and function.

  • Vector Construction: PCR-based modules with C-terminal H/KDEL retrieval motifs have been developed specifically for ER-resident proteins . These include codon-optimized epitopes and fluorescent protein variants suitable for the ER environment.

  • Purification Strategy: For membrane proteins like ERD1, detergent-based extraction followed by affinity chromatography is typically employed. Tag selection (His, FLAG, etc.) should consider the structural features of ERD1 to minimize interference with function.

  • Functional Verification: Complementation assays in erd1Δ strains provide the most direct evidence of functional expression. Key phenotypes to assess include:

    • Retention of ER-resident proteins (measured by secretion assays)

    • Glycoprotein processing in the Golgi

    • Hygromycin sensitivity (as observed in genetic studies)

  • Structural Characterization: Size exclusion chromatography to determine oligomeric state, circular dichroism for secondary structure analysis, and fluorescence spectroscopy for tertiary structure examination.

How can researchers design experiments to study ERD1-dependent protein trafficking?

To effectively study ERD1-dependent protein trafficking, researchers should consider multiple complementary approaches:

  • Reporter Protein Systems:

    • Express reporter proteins with HDEL/KDEL retention signals (e.g., BiP-GFP, PDI-GFP)

    • Compare their localization and secretion in wild-type versus erd1Δ strains

    • Quantify retention efficiency through biochemical fractionation and fluorescence microscopy

  • Pulse-Chase Analysis:

    • Metabolically label newly synthesized proteins with radioactive amino acids

    • Track the fate of labeled ER proteins over time in the presence or absence of ERD1

    • Immunoprecipitate specific proteins of interest at various timepoints

  • Live Cell Imaging:

    • Use fluorescently tagged ER proteins to visualize trafficking in real-time

    • Employ photoactivatable or photoconvertible fluorescent proteins to track specific protein populations

    • Perform FRAP (Fluorescence Recovery After Photobleaching) to measure dynamics

  • Genetic Interaction Analysis:

    • Leverage the known genetic interactions (e.g., with Gyp1, COG complex components)

    • Create double mutants to assess epistatic relationships

    • Use dosage suppressor screens to identify additional components of the pathway

  • Biochemical Reconstitution:

    • Isolate vesicles from wild-type and erd1Δ cells

    • Perform in vitro budding and fusion assays to assess specific steps in the trafficking pathway

    • Reconstitute minimal systems with purified components to determine direct interactions

How does ERD1 contribute to ER structure and organization?

While ERD1 is primarily known for its role in protein retention, its status as a multi-pass membrane protein suggests potential contributions to ER structure. Studies on ER morphology in yeast provide context for understanding how membrane proteins influence ER organization:

  • ER Domain Organization: The yeast ER is organized into distinct domains including cisternae, tubules, and plasma membrane-associated ER (pmaER) . Membrane proteins like ERD1 may contribute to domain-specific functions.

  • Membrane Curvature: While proteins like Rtn1, Rtn2, and Yop1 are known to influence ER membrane curvature , multi-pass membrane proteins like ERD1 may also affect local membrane properties.

  • Ribosome Association: Changes in ER protein composition can affect ribosome density on the ER membrane . ERD1's role in protein retention might indirectly influence the distribution of ribosomes and thus protein synthesis capacity.

  • ER-Golgi Contact Sites: As a protein involved in ER-Golgi trafficking, ERD1 may participate in organizing contact sites between these organelles, which are critical for efficient protein transport.

To study these aspects, advanced imaging techniques such as electron tomography, super-resolution microscopy, and correlative light and electron microscopy (CLEM) are recommended. These methods can reveal the nanoscale organization of the ER and the specific distribution of ERD1 within this network.

What approaches are useful for studying ERD1 function in relation to cellular stress responses?

ERD1's role in ER protein retention connects it to cellular stress responses, particularly the unfolded protein response (UPR). To investigate this relationship, researchers should consider:

  • Stress Induction Experiments:

    • Compare UPR activation in wild-type versus erd1Δ strains under various stressors (tunicamycin, DTT, heat shock)

    • Measure UPR activation using reporters (e.g., UPRE-lacZ) or by assessing Hac1 splicing

    • Analyze transcriptional changes using RNA-seq or qPCR of UPR target genes

  • Proteostasis Assessment:

    • Measure protein aggregation and misfolding in the presence or absence of ERD1

    • Use proteomics approaches to identify changes in the ER proteome

    • Assess chaperone distribution and activity in erd1Δ cells

  • Genetic Interaction Analysis Under Stress:

    • Screen for genetic interactions specific to stress conditions

    • Identify suppressors or enhancers of erd1Δ phenotypes under stress

    • Create and analyze double mutants with key UPR components (e.g., ire1Δ erd1Δ)

  • Integrated Cellular Response:

    • Assess effects on related processes such as ERAD, autophagy, and lipid metabolism

    • Measure cell growth and viability under various stress conditions

    • Analyze the timing and coordination of different stress response pathways

How can ERD1 research inform biotechnological applications in recombinant protein production?

Understanding ERD1 function has significant implications for improving recombinant protein production in S. cerevisiae, which is used to produce approximately 20% of protein-based biopharmaceuticals on the market . Research insights can be applied in several ways:

  • Enhancing Secretion Efficiency:

    • Strategic modification of ERD1 function could allow controlled "leakage" of desired recombinant proteins

    • Engineering retention signal variants with calibrated affinity for the retrieval machinery

    • Creating conditional ERD1 mutants that allow switchable retention/secretion systems

  • Improving Protein Quality:

    • ERD1's role in ER-Golgi trafficking affects glycosylation patterns

    • Understanding and manipulating this pathway could lead to more homogeneous glycoprotein products

    • Optimizing the balance between ER retention time (for proper folding) and secretion efficiency

  • Strain Development:

    • Rational engineering of ERD1 and interacting components for improved production hosts

    • Creation of specialized strains for different classes of recombinant proteins

    • Integration of ERD1 modifications with other cellular engineering approaches

What are the most promising directions for future research on ERD1?

Several research directions offer particularly high potential for advancing our understanding of ERD1:

  • Structural Biology:

    • Determination of ERD1's three-dimensional structure would provide crucial insights into its mechanism

    • Cryo-EM studies of ERD1 in membrane environments could reveal how it interacts with the lipid bilayer

    • Structural comparisons with homologs from other organisms to identify conserved functional elements

  • Systems Biology:

    • Comprehensive mapping of the ERD1 interactome under various conditions

    • Integration of genetic, proteomic, and functional data to build predictive models of ERD1 function

    • Network analysis to position ERD1 within the broader context of cellular trafficking systems

  • Synthetic Biology:

    • Engineering ERD1 variants with novel or enhanced functions

    • Development of ERD1-based tools for controlling protein localization and secretion

    • Creation of synthetic trafficking pathways incorporating modified ERD1 components

  • Comparative Biology:

    • Analysis of ERD1 function across different yeast species and other eukaryotes

    • Evolutionary studies to trace the diversification of ER retention mechanisms

    • Identification of species-specific adaptations in ERD1 function related to ecological niches

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.