Recombinant Saccharomyces cerevisiae Protein FUN14 (FUN14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
FUN14; YAL008W; Protein FUN14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-198
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FUN14
Target Protein Sequence
MTLAFNMQRLVFRNLNVGKRMFKNVPLWRFNVANKLGKPLTRSVGLGGAGIVAGGFYLMN RQPSKLIFNDSLGAAVKQQGPLEPTVGNSTAITEERRNKISSHKQMFLGSLFGVVLGVTV AKISILFMYVGITSMLLCEWLRYKGWIRINLKNIKSVIVLKDVDLKKLLIDGLLGTEYMG FKVFFTLSFVLASLNANK
Uniprot No.

Target Background

Database Links

KEGG: sce:YAL008W

STRING: 4932.YAL008W

Protein Families
FUN14 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is FUNDC1 and what is its biological significance?

FUNDC1 (FUN14 domain-containing protein 1) is a mitochondrial outer membrane protein that primarily functions as a receptor for hypoxia-induced mitophagy. The protein contains specific phosphorylation sites (Ser13, Tyr18, Ser17) and a ubiquitination site (Lys119) that regulate its activity. FUNDC1 plays critical roles in maintaining mitochondrial quality control and is increasingly recognized for its importance in cardiovascular health and disease .

What is the structure of FUNDC1 and its functional domains?

FUNDC1 is an integral membrane protein with its N-terminal domain facing the cytoplasm. The protein contains a FUN14 domain that is evolutionarily conserved. Key structural features include:

  • A cytoplasmic N-terminal domain essential for interaction with proteins like KLC1

  • An LC3 interaction region (LIR) necessary for mitophagy

  • Multiple phosphorylation sites that regulate its activity (Ser13, Tyr18, Ser17)

  • A ubiquitination site at Lys119

  • Transmembrane domains that anchor it to the outer mitochondrial membrane

How does FUNDC1-mediated mitophagy differ from other mitophagy pathways?

FUNDC1-mediated mitophagy is primarily activated by hypoxic conditions and is regulated through specific post-translational modifications. Unlike other mitophagy pathways, FUNDC1-mediated mitophagy is controlled by phosphorylation status: dephosphorylation of Ser13 and Tyr18 sites and phosphorylation of the Ser17 site activate mitophagy, while phosphorylation of Ser13 and Tyr18 inhibits it. Additionally, ubiquitination of the Lys119 site plays a role in regulating FUNDC1-mediated mitophagy. This pathway is particularly important in cardiac tissues and may contribute to cardioprotection through effective mitochondrial quality control .

What are the recommended methods for expressing recombinant FUNDC1 in Saccharomyces cerevisiae?

For expressing recombinant FUNDC1 in S. cerevisiae, several approaches have proven effective:

  • Plasmid Selection: Using expression vectors like pBBH1 or pBBH4, which can carry secretion signals (e.g., XYNSEC signal for extracellular secretion) .

  • Transformation Methods:

    • Yeast Mediated Ligation (YML) has been successfully used for cloning

    • Electroporation following Sambrook et al. (1989) and Cripwell et al. (2019) protocols

  • Promoter Selection: Selecting appropriate promoters based on expression goals (constitutive vs. inducible)

  • Signal Sequence Optimization: While the α-factor leader sequence has proven efficient for many proteins, it's advisable to experimentally evaluate different leaders such as INU1, SUC2, PHO5, MEL1, or the viral leader from K28 preprotoxin for optimal FUNDC1 expression .

How can I verify successful expression and proper localization of FUNDC1?

Verification of FUNDC1 expression and localization can be achieved through:

  • PCR Confirmation: Using specific primers (similar to how FUM1 gene confirmation was performed with F-FUM1(63U) and R-FUM1(86D) primers)

  • Co-localization Studies: Co-expression with known mitochondrial markers followed by fluorescence microscopy

  • Co-immunoprecipitation: As demonstrated in studies with KLC1, FUNDC1 can be verified through co-immunoprecipitation with interaction partners

  • Subcellular Fractionation: To confirm mitochondrial outer membrane localization

  • Western Blotting: Using antibodies specific to FUNDC1 or to tags fused to the recombinant protein

What are the most effective methods to study FUNDC1 phosphorylation status?

To effectively study FUNDC1 phosphorylation status, researchers should consider:

  • Phospho-specific Antibodies: Develop or obtain antibodies specific to phosphorylated Ser13, Tyr18, and Ser17 sites

  • Mass Spectrometry: For comprehensive phosphorylation profiling

  • Phosphomimetic Mutations: Creating S13D/E, Y18D/E, or S17A mutants to mimic permanent phosphorylation or dephosphorylation states

  • In vitro Kinase Assays: To identify kinases responsible for specific phosphorylation events (known kinases include Casein kinase 2 for Ser13, Src proto-oncogene kinase for Tyr18, and ULK1 for Ser17)

  • Pharmacological Inhibitors: Using specific kinase or phosphatase inhibitors to manipulate phosphorylation status

How can I investigate the interaction between FUNDC1 and LC3 during mitophagy in yeast models?

To investigate FUNDC1-LC3 interactions:

  • Yeast Two-Hybrid Assays: Similar to the method used to identify KLC1-FUNDC1 interaction

  • CRISPR-Based Approaches: The CRISPR D-BUGS protocol used in synthetic yeast chromosome studies could be adapted to explore FUNDC1-LC3 interactions

  • Fluorescence Resonance Energy Transfer (FRET): To detect direct protein-protein interactions in living cells

  • Co-immunoprecipitation Under Hypoxic Conditions: To capture physiologically relevant interactions

  • Mutational Analysis: Creating mutations in the LC3 interaction region (LIR) of FUNDC1 to disrupt binding and observe functional consequences

  • Proximity Labeling: Using BioID or APEX2 fused to FUNDC1 to identify proximal proteins during mitophagy

What experimental approaches can distinguish between FUNDC1's roles in mitophagy versus other mitochondrial functions?

To differentiate FUNDC1's various functions:

  • Domain-Specific Mutations: Creating mutations that affect specific interactions while preserving others

  • Temporal Control Systems: Using rapidly inducible expression systems to observe immediate effects

  • Specific Interactor Knockouts: Eliminating binding partners involved in specific pathways

  • Mitophagy-Specific vs. General Mitochondrial Assays:

    • Mitophagy flux assays (e.g., mt-Keima)

    • Mitochondrial membrane potential measurements

    • Respiration assays

    • Mitochondrial morphology assessment

  • Stress-Specific Activation: Comparing hypoxia-induced effects to other stressors

What considerations are important when manipulating FUNDC1 phosphorylation sites for functional studies?

Key considerations include:

  • Phosphosite Interdependence: Recognize that the phosphorylation status of one site may influence others

  • Temporal Dynamics: Account for the kinetics of phosphorylation/dephosphorylation events

  • Phosphomimetic Limitations: Acknowledge that phosphomimetic mutations (D/E for phospho-S/T, F for phospho-Y) may not perfectly replicate phosphorylation effects

  • Kinase/Phosphatase Specificity: Consider that manipulating a kinase/phosphatase may affect targets beyond FUNDC1

  • Physiological Context: Ensure experimental conditions appropriately model the physiological state being studied (e.g., hypoxia)

  • Combinatorial Modifications: Consider the interplay between phosphorylation and ubiquitination at Lys119

How can I differentiate between direct and indirect effects when studying FUNDC1's impact on mitochondrial function?

Differentiating direct from indirect effects requires:

  • Acute vs. Chronic Manipulations: Compare immediate responses to long-term adaptations

  • Dose-Response Relationships: Titrate FUNDC1 expression levels or activity

  • Rescue Experiments: Attempt to rescue phenotypes with wild-type or mutant FUNDC1

  • Pathway Inhibition: Selectively block downstream pathways to isolate effects

  • Single-Cell Analysis: Examine cell-to-cell variation in responses

  • Temporal Sequencing of Events: Establish the order of cellular events following FUNDC1 manipulation

What are the common pitfalls in interpreting FUNDC1 mutation studies in yeast?

Common pitfalls include:

  • Overlooking Genomic Context Effects: As demonstrated in synthetic chromosome studies (synXVI), modifications like loxPsym sites can impact nearby gene expression and yield misleading phenotypes

  • Mutation Rate Variability: The mutation rate in S. cerevisiae is not uniform across the genome, with significant differences observed between different loci (e.g., URA3 vs. CAN1)

  • Leader Sequence Issues: Inappropriate leader sequence selection can result in protein mislocalization or impaired secretion

  • Strain Background Effects: Different S. cerevisiae strains may show variable phenotypes with identical mutations

  • Hypermorphic vs. Hypomorphic Effects: Mutations may result in gain-of-function or loss-of-function, requiring careful characterization

How should contradictory data about FUNDC1 function be reconciled across different experimental systems?

To reconcile contradictory findings:

  • System-Specific Contexts: Consider that FUNDC1 may function differently in different cellular contexts or species

  • Technical Variations: Evaluate differences in experimental methods, including:

    • Expression levels (overexpression vs. endogenous)

    • Fusion tags that may interfere with function

    • Cell culture conditions

  • Developmental or Physiological State: Consider the metabolic state or developmental stage of the cells/organisms

  • Interaction Partner Availability: The presence or absence of binding partners may alter FUNDC1 function

  • Post-translational Modification Status: Different experimental systems may result in different patterns of phosphorylation or ubiquitination

What emerging technologies might advance our understanding of FUNDC1 function in yeast?

Promising technologies include:

  • Synthetic Genomics Approaches: Building on the Sc2.0 project to create synthetic versions of FUNDC1 with enhanced features or novel functionalities

  • CRISPR D-BUGS Protocol: Applying this debugging approach to systematically identify functional domains and potential defective loci in FUNDC1

  • Single-Molecule Imaging: To track individual FUNDC1 molecules during mitophagy

  • Microfluidics-Based Approaches: For precise control of cellular environment and real-time observation

  • Protein Structure Prediction: Leveraging AI-based tools like AlphaFold to predict structural features of FUNDC1 and its complexes

How might FUNDC1's interaction with the kinesin system be exploited for mitochondrial research?

The FUNDC1-kinesin interaction opens several research avenues:

  • Mitochondrial Trafficking Studies: Leveraging the interaction between FUNDC1 and KLC1 to study mitochondrial movement along microtubules

  • Competition with LC3: Investigating how KLC1 may compete with LC3 for binding to FUNDC1, potentially regulating mitophagy

  • Targeted Mitochondrial Delivery: Exploiting FUNDC1-kinesin interactions to deliver cargo to specific mitochondrial populations

  • Real-time Visualization: Developing fluorescent tags to monitor FUNDC1-kinesin interactions during mitochondrial dynamics

  • Therapeutic Targeting: Identifying small molecules that modulate the FUNDC1-kinesin interaction for potential cardiovascular applications

What are the implications of FUNDC1 research for understanding and treating cardiovascular diseases?

FUNDC1 research has significant cardiovascular implications:

  • Exercise Preconditioning: Understanding how FUNDC1-mediated mitophagy contributes to exercise preconditioning (EP) for cardioprotection

  • Mitochondrial Quality Control: Developing strategies to fine-tune FUNDC1-mediated mitophagy to maintain optimal mitochondrial quality without triggering excessive mitophagy and apoptosis

  • Hypoxia Response: Exploring how FUNDC1 mediates cardiac adaptation to hypoxic conditions

  • Therapeutic Targeting: Identifying compounds that selectively modify FUNDC1 phosphorylation status to promote cardioprotection

  • Biomarker Development: Evaluating FUNDC1 protein levels or phosphorylation status as potential biomarkers for cardiovascular disease risk or treatment response

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.