Recombinant Saccharomyces cerevisiae Protein HPH1 (FRT1)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae Protein HPH1 (FRT1), also known as Protein HPH1, is a tail-anchored endoplasmic reticulum (ER) membrane protein found in Saccharomyces cerevisiae . Its precise function remains unknown, but it is recognized as a substrate for calcineurin, a phosphatase, and it interacts with its homolog Frt2p . Furthermore, HPH1 potentially facilitates cell growth under stress conditions, possibly through involvement in post-translational translocation .

  • FRT1 has a paralog, FRT2, that arose from whole genome duplication .

  • The STRING database identifier for FRT1 is 4932.YOR324C .

Structure and Properties

HPH1 is a protein consisting of 602 amino acids . Recombinant forms of this protein can be produced using in vitro E. coli expression systems . It can also be produced with a His-tag, and the purity of such recombinant proteins can be greater than 90% as determined by SDS-PAGE .

Function and Interactions

HPH1 is involved in tolerance to high pH levels and possibly to azoles . It interacts with Frt2p and is a substrate of calcineurin, which is essential for yeast survival during environmental stresses, such as high concentrations of Na+ and Li+ . Calcineurin may also regulate Hsl1 protein kinase and the Skn7 transcription modulator .

Predicted Functional Partners of FRT1:

  • CNA1: Serine/threonine-protein phosphatase 2B catalytic subunit A1; Calcineurin A.

  • SLM1: Phosphatidylinositol 4,5-bisphosphate-binding protein SLM1.

  • SEC63: Protein translocation protein SEC63.

Role in Stress Response and Cell Death

HPH1 (Frt1) and HPH2 (Frt2) are ER-resident proteins that calcineurin can dephosphorylate or regulate in response to a high environmental pH, which depolarizes the cell and rapidly activates the Cch1-dependent Ca2+ channel . Inhibitors of Hsp90 have been shown to diminish calcineurin signaling in S. cerevisiae .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them during order placement.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you require a specific tag, please specify it; we will prioritize its use.
Synonyms
FRT1; HPH1; YOR324C; O6159; Protein HPH1; Functionally related to TCP1 protein 1; High pH protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-602
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
FRT1
Target Protein Sequence
MNLLIDRMENPGSRNCTLLPPSFPRGFCKGRRASSGDAVKIKESGLQPQPQPEPLQAKTN VAHFSKSSSRLPVIAVNDNPVVPRPSTEVNLGSLLQKEREKEKEEQPALHDRRHLYVTKN RAHGVRQRSLEMTSLPVLGSTKTGKFSDFLFEDDIDNRVGRHSRSYSGASSLDDPFRVSP KTDFNSNRARLSCLSKGRRGSMSVFQSCHTGLAFNQIQGSSSSQRRSSAGSFDYERKRLV NQFLQPSLGNSDPFDTLRESVVFEPSSTAGGIKLGNMHSQSQISVNSSPSTSLFYHDLDG SAVNDSSSFLYSRSNVPAFLSSSAFSSTSSTSSDSEDVDRRSLNGVYPSLGYLTNQRKPR NSSGSSTAPGTDTLGFKYLLNRQKSADSSTRFKSVLKVNNNNGSAATPDSSSNSISKSNS NLNDNIDELNYYQNHISTLLVKIENEMRRNLNDTIIKNENNVQKTIQKYDLLSGELTLLL DEMTTLRTTVINQFLVKLKSDFDEDDNKAFINELKISVEESVAQLQGLERRMEVCQERLN KQKSSLREMDSLIELKNVLNKSKNNTKSIYLYRYFIIDIIAFLLMGGFIVYVKNLLTRFF TR
Uniprot No.

Target Background

Function

HPH1 (FRT1) is a calcineurin-dependent protein essential for growth under conditions of high salinity, alkaline pH, and cell wall stress.

Gene References Into Functions
  1. Calcineurin directly dephosphorylates Hph1p and interacts with it via a sequence motif (PVIAVN) within Hph1p. PMID: 15189990
Database Links

KEGG: sce:YOR324C

STRING: 4932.YOR324C

Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Note=Punctate foci at the endoplasmic reticulum membrane. The distribution of FRT1 on the endoplasmic reticulum membrane depends on CaCl2 and calcineurin activity.

Q&A

What is HPH1 (FRT1) and what is its cellular localization?

HPH1 (also known as FRT1, YOR324C) is a tail-anchored integral membrane protein localized to the endoplasmic reticulum (ER) in Saccharomyces cerevisiae. The protein's function is not fully characterized, but it is known to be a substrate of the phosphatase calcineurin and plays a role in promoting cell growth under stress conditions. HPH1 is believed to function in posttranslational translocation pathways, helping cells cope with various environmental stressors. The protein contains 602 amino acids and is anchored to the ER membrane via its C-terminal domain, with the majority of the protein facing the cytosolic side.

What is the relationship between HPH1 and HPH2?

HPH1 and its homolog HPH2 (YAL028W) arose from whole genome duplication in yeast and share significant sequence similarity. Both encode tail-anchored integral membrane proteins that directly interact with each other, as demonstrated through yeast two-hybrid assays. These proteins function redundantly in certain stress response pathways, particularly those mediated by calcineurin. Gene knockout studies have shown that while individual deletion of either gene produces minimal phenotypic effects, double deletion mutants (hph1Δhph2Δ) display enhanced sensitivity to various stress conditions, indicating their functional redundancy in stress tolerance mechanisms.

What are the known protein interactions of HPH1?

HPH1 participates in several key protein-protein interactions that provide insight into its cellular functions:

Interacting PartnerInteraction ScoreFunctional Relationship
CNA10.767Calcineurin A subunit; HPH1 is a substrate
CMP20.665Alternative calcineurin A isoform
FRT2 (HPH2)0.640Homolog with redundant functions
YIR042C0.627Putative protein of unknown function

HPH1 forms a stable interaction with the calcineurin phosphatase complex, which is critical for cellular responses to environmental stresses. The interaction with its paralog FRT2 (HPH2) suggests the formation of heterodimeric complexes that may be functionally important for their role in stress response pathways. These interactions have been identified through various experimental approaches including yeast two-hybrid screens and co-immunoprecipitation studies.

How is HPH1/FRT1 expression regulated in yeast cells?

The expression of HPH1 is regulated in response to various stress conditions, particularly those that activate the calcineurin signaling pathway. Calcineurin is a Ca²⁺/calmodulin-regulated protein phosphatase that controls various stress responses in yeast. Under conditions of high Na⁺, alkaline pH, or cell wall stress, HPH1 expression is modulated as part of the adaptive response. The regulation involves both transcriptional and post-translational mechanisms. At the post-translational level, HPH1 is a direct substrate of calcineurin, suggesting that its activity or localization may be regulated through dephosphorylation events. This regulatory relationship places HPH1 within the broader context of calcineurin-mediated stress response pathways in yeast.

What methods are most effective for recombinant expression and purification of HPH1?

For effective recombinant expression and purification of HPH1, consider the following methodological approach:

  • Expression System Selection: Given that HPH1 is a membrane protein, specialized expression systems are required. The most effective approach involves using S. cerevisiae itself as an expression host, particularly strains optimized for membrane protein production. Expression in E. coli systems often leads to protein misfolding or aggregation due to the lack of appropriate post-translational modifications.

  • Vector Design: For optimal expression, design vectors with:

    • Strong inducible promoters (GAL1 or MET25)

    • Appropriate fusion tags (His6 or FLAG) positioned to not interfere with membrane insertion

    • Signal sequences that ensure proper ER targeting

  • Purification Strategy:

    • Solubilize membranes using mild detergents (n-dodecyl-β-D-maltoside or digitonin)

    • Employ affinity chromatography based on engineered tags

    • Consider native purification approaches to maintain interaction with binding partners like calcineurin

  • Protein Quality Assessment:

    • Size exclusion chromatography to verify proper folding

    • Circular dichroism to assess secondary structure integrity

    • Functional assays to confirm biological activity

These approaches should be tailored to specific experimental goals, keeping in mind that membrane proteins like HPH1 require careful handling to maintain their native structure and function.

How can researchers investigate HPH1's role in stress response pathways?

To effectively investigate HPH1's role in stress response pathways, researchers should implement a multi-faceted experimental approach:

  • Genetic Manipulation Strategies:

    • Generate single (hph1Δ) and double (hph1Δhph2Δ) knockout strains

    • Create point mutations in key domains, particularly potential phosphorylation sites

    • Develop conditional expression systems to control HPH1 levels

  • Stress Response Phenotypic Assays:

    • Systematically test growth under various stressors (high Na⁺, alkaline pH, cell wall stress)

    • Quantify growth rates and survival percentages under stress conditions

    • Compare wild-type, single mutant, and double mutant responses to identify specific pathways

  • Molecular Analysis:

    • Monitor HPH1 phosphorylation status under different stress conditions

    • Perform RNA-seq to identify transcriptional changes in HPH1-deficient strains

    • Use ChIP-seq to identify downstream targets in stress response pathways

  • Interaction Studies:

    • Perform co-immunoprecipitation with calcineurin components under stress conditions

    • Use proximity labeling techniques to identify stress-specific interaction partners

    • Implement FRET or BiFC to visualize dynamic interactions during stress response

This comprehensive approach will help elucidate the specific mechanisms through which HPH1 contributes to cellular stress tolerance, particularly in relation to calcineurin signaling pathways.

What is the relationship between HPH1 and vacuolar acidification?

The relationship between HPH1 and vacuolar acidification represents an interesting research area with somewhat contradictory findings:

HPH1 and HPH2 were identified in a genome-wide enhancer screen using mutant alleles of V-ATPase assembly factors (vma21QQ and vma21QQ/voa1Δ). This screen was designed to identify elements affecting V-ATPase assembly, trafficking, or enzyme activity. The V-ATPase complex is critical for organelle acidification, particularly of the vacuole in yeast cells. Mutations in HPH1/HPH2 showed synthetic growth defects when combined with the vma21QQ allele, suggesting a functional relationship with the V-ATPase pathway.

This apparent contradiction can be resolved by considering that HPH1/HPH2 may affect stress response pathways that become critical when V-ATPase function is compromised, rather than directly regulating V-ATPase activity themselves. This represents an important distinction for researchers designing experiments to study HPH1 function in relation to vacuolar processes.

How does HPH1 function in the context of the unfolded protein response (UPR)?

While direct evidence linking HPH1 to the unfolded protein response (UPR) is limited, several connections can be drawn based on its localization and function:

  • ER Localization Context: As a tail-anchored ER membrane protein, HPH1 resides in the same compartment where the UPR is initiated. The UPR is activated when unfolded proteins accumulate in the ER, triggering a signaling cascade initiated by Ire1p.

  • Stress Response Connection: Both HPH1 and the UPR are involved in cellular stress responses. HPH1 promotes growth under stress conditions including high Na⁺, alkaline pH, and cell wall stress, while the UPR is activated under ER stress conditions.

  • Potential Role in Protein Processing: HPH1 has been implicated in posttranslational translocation, which suggests it may influence protein folding or processing in the ER. Disruptions in these processes could potentially trigger or modulate the UPR.

  • Research Approach for Investigating HPH1-UPR Connections:

    • Monitor UPR activation markers (HAC1 splicing, UPR target gene expression) in HPH1-deficient strains

    • Test for genetic interactions between HPH1 and key UPR components (IRE1, HAC1)

    • Examine HPH1 localization and expression changes during ER stress conditions

    • Assess whether calcineurin-mediated regulation of HPH1 intersects with UPR signaling pathways

Understanding these potential connections requires experimental validation, as current literature does not definitively establish a direct functional link between HPH1 and the UPR machinery.

How should I design experiments to differentiate between HPH1 and FRT2 (HPH2) functions?

Designing experiments to differentiate between the functions of these paralogous proteins requires strategies that can overcome their functional redundancy:

  • Genetic Approach:

    • Create single and double knockout strains (hph1Δ, hph2Δ, and hph1Δhph2Δ)

    • Generate strains with swapped promoters to test whether expression patterns dictate functional differences

    • Design domain swap chimeric proteins to identify regions responsible for unique functions

  • Protein Localization Studies:

    • Use fluorescent protein tagging (ensuring tags don't disrupt function) to examine subcellular localization

    • Implement super-resolution microscopy to detect potential micro-domain differences within the ER

    • Perform fractionation studies to determine if the proteins occupy different ER subdomains

  • Interaction Profiling:

    • Conduct parallel protein-protein interaction studies (BioID, AP-MS) to identify unique binding partners

    • Compare phosphorylation patterns and kinetics following calcineurin activation

    • Assess homo- vs. hetero-dimerization propensities through in vitro and in vivo approaches

  • Stress-Specific Functional Assays:

    • Test recovery kinetics after exposure to different stressors

    • Measure protein half-lives under various stress conditions

    • Analyze transcriptional responses to stress in single knockout backgrounds

  • Experimental Design Considerations:

    • Include appropriate controls for protein expression levels to account for dosage effects

    • Consider evolutionary conservation patterns to identify potentially divergent functional domains

    • Design time-course experiments to capture dynamic or transient functional differences

This multifaceted approach should help reveal subtle functional distinctions between these highly similar proteins that may not be apparent from single experimental approaches.

What controls are essential when investigating HPH1 in genetic screens?

When conducting genetic screens involving HPH1, several critical controls should be incorporated to ensure reliable and interpretable results:

  • Strain Background Controls:

    • Use isogenic strains that differ only in the specific genetic modifications being tested

    • Include wild-type, single mutant (hph1Δ), and double mutant (hph1Δhph2Δ) controls in all experiments

    • Consider potential strain-specific effects by validating key findings in multiple strain backgrounds

  • Expression Level Controls:

    • Monitor HPH1 expression levels when using overexpression or conditional expression systems

    • Employ quantitative western blotting to ensure comparable protein levels across experimental conditions

    • Consider using native promoters with epitope tags rather than heterologous promoters when possible

  • Functional Complementation Controls:

    • Verify that phenotypes can be rescued by reintroducing wild-type HPH1

    • Include non-functional HPH1 mutants (e.g., membrane-anchoring deficient variants) as negative controls

    • Test cross-complementation with HPH2 to assess functional redundancy

  • Screening Specificity Controls:

    • Include unrelated genes with known phenotypes to validate screen sensitivity and specificity

    • Implement secondary validation screens to eliminate false positives

    • Confirm genetic interactions through independent methodologies (e.g., tetrad analysis, growth assays)

  • Stress Condition Controls:

    • Carefully titrate stress conditions to identify optimal ranges for phenotypic differentiation

    • Include time-course measurements to capture both acute and adaptive responses

    • Control for general growth defects versus specific stress sensitivity

In the specific case of synthetic genetic screens like the V-ATPase assembly factor screen that identified HPH1, it's essential to distinguish between direct functional relationships and indirect genetic interactions by including appropriate pathway-specific controls.

How can I optimize protein interaction studies for membrane proteins like HPH1?

Membrane proteins present unique challenges for interaction studies due to their hydrophobic nature and complex topological arrangements. For optimal results with HPH1, consider the following methodological approaches:

  • Sample Preparation Optimization:

    • Carefully select detergents based on HPH1's specific properties (mild non-ionic detergents like DDM or digitonin often work well)

    • Consider membrane-mimetic systems (nanodiscs, liposomes) to maintain native-like environments

    • Implement gentle solubilization protocols with temperature control to preserve interactions

  • In Vivo Interaction Methods:

    • Employ proximity-based labeling techniques (BioID, APEX) that work effectively with membrane proteins

    • Utilize split-protein complementation assays (Split-GFP, BiFC) optimized for ER membrane proteins

    • Consider FRET-based approaches for monitoring dynamic interactions in live cells

  • Co-immunoprecipitation Adaptations:

    • Use reversible crosslinking to stabilize transient interactions before solubilization

    • Implement stringent wash conditions with detergent present to reduce non-specific binding

    • Consider native co-IP approaches that preserve membrane integrity during isolation

  • Functional Validation Strategies:

    • Design genetic experiments to confirm biological relevance of detected interactions

    • Implement mutagenesis of key residues to disrupt specific interactions

    • Correlate interaction patterns with functional outcomes under various stress conditions

  • Control Considerations:

    • Include topology controls to ensure accessibility of epitope tags

    • Validate that fusion tags don't disrupt membrane insertion or protein folding

    • Compare results across multiple interaction detection methods

This methodological framework should be tailored to the specific research questions being addressed about HPH1 and its interaction partners, particularly its relationship with calcineurin components and its homolog HPH2.

How should contradictory data about HPH1 function be addressed?

When encountering contradictory data regarding HPH1 function, implement the following systematic approach:

  • Contextual Analysis:

    • Examine experimental conditions closely, particularly stress types, intensities, and durations

    • Consider strain background differences that might influence phenotypic outcomes

    • Evaluate protein expression levels across contradictory studies

  • Methodological Reconciliation:

    • Compare assay sensitivities and detection limits

    • Assess whether different methodologies measure the same or different aspects of function

    • Implement orthogonal approaches to validate key findings

  • Functional Redundancy Considerations:

    • Determine whether HPH2 compensation varies across experimental contexts

    • Evaluate potential condition-specific functions that might not be apparent in all assays

    • Consider adaptive responses that might mask phenotypes in certain experimental designs

  • Resolution Strategies:

    • Design definitive experiments that directly test contradictory findings under identical conditions

    • Implement time-course studies to capture dynamic aspects that might explain discrepancies

    • Consider that contradictions may reveal condition-specific or context-dependent functions

For example, the apparent contradiction regarding HPH1's relationship with vacuolar acidification (identified in genetic screens but showing no direct effect on V-ATPase function) can be resolved by recognizing that HPH1 may become important only when V-ATPase function is already compromised. This example demonstrates how seemingly contradictory findings can lead to more nuanced understanding of protein function.

What statistical approaches are recommended for analyzing HPH1 phenotypic data?

The analysis of HPH1 phenotypic data requires robust statistical approaches tailored to the specific experimental design and data characteristics:

  • Growth Assay Analysis:

    • For continuous growth measurements (e.g., plate reader data): Mixed-effects models to account for technical and biological replication

    • For endpoint measurements: ANOVA with appropriate post-hoc tests (Tukey's HSD for all pairwise comparisons)

    • Growth curve analysis: Parameter extraction (lag phase, maximum growth rate, carrying capacity) followed by multivariate analysis

  • Stress Response Data:

    • Survival analysis approaches for time-to-event data (e.g., Kaplan-Meier with log-rank tests)

    • Dose-response modeling for stress titration experiments (EC50 determination)

    • Two-way ANOVA to assess genotype-by-condition interactions

  • Genetic Interaction Analysis:

    • Calculate genetic interaction scores (ε = observed_double_mutant - expected_double_mutant)

    • Implement appropriate null models for expected phenotypes (multiplicative or additive)

    • Apply false discovery rate (FDR) corrections for multiple hypothesis testing

  • Replication and Validation:

    • Power analysis to determine appropriate sample sizes for detecting expected effect sizes

    • Bootstrap or jackknife resampling to assess result robustness

    • Cross-validation approaches for predictive modeling

  • Data Visualization Recommendations:

    • Use box plots with individual data points for group comparisons

    • Implement heat maps for condition-by-genotype interaction visualization

    • Consider principal component analysis for multivariate phenotypic data

By applying these statistical approaches, researchers can properly interpret phenotypic data related to HPH1 function, particularly in the context of stress responses and genetic interactions with pathways such as V-ATPase function and calcineurin signaling.

How can systems biology approaches enhance our understanding of HPH1 function?

Systems biology approaches offer powerful frameworks for integrating diverse data types to develop a comprehensive understanding of HPH1 function:

  • Network Analysis Applications:

    • Construct protein-protein interaction networks centered on HPH1 and its partners

    • Identify network modules and functional clusters associated with HPH1

    • Apply centrality measures to assess HPH1's position within stress response networks

  • Multi-omics Integration Strategies:

    • Combine transcriptomics, proteomics, and metabolomics data from HPH1-deficient strains

    • Implement correlation network analysis to identify coordinated changes across omics layers

    • Use pathway enrichment analysis to contextualize HPH1 within cellular processes

  • Mathematical Modeling Approaches:

    • Develop ordinary differential equation models of HPH1-involved stress response pathways

    • Simulate the effects of HPH1 perturbation on system dynamics

    • Similar to models developed for UPR activation, create predictive models for HPH1-mediated stress responses

  • Evolutionary Systems Biology:

    • Compare HPH1/HPH2 duplicates across yeast species to understand functional divergence

    • Apply phylogenetic approaches to identify conserved functional domains

    • Use comparative genomics to place HPH1 in evolutionary context

  • Data Integration Framework:

    • Implement Bayesian networks to integrate diverse evidence types

    • Develop machine learning approaches to predict condition-specific functions

    • Create interactive visualization tools for exploring HPH1-related data across experimental conditions

These systems approaches are particularly valuable for understanding proteins like HPH1 that function in complex cellular contexts and may have condition-specific roles that are difficult to capture with reductionist approaches alone.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.