Recombinant Saccharomyces cerevisiae Protein HPH2 (FRT2)

What is HPH2 (FRT2) and what are its structural characteristics?

HPH2 (also known as FRT2, YAL028W, Functionally related to TCP1 protein 2, or High pH protein 2) is a 528 amino acid tail-anchored integral membrane protein found in Saccharomyces cerevisiae. The protein contains a full-length sequence with specific domains that contribute to its function in stress response pathways .

The protein structure includes a complete amino acid sequence that begins with MQNAQIKSSSKGSGIDGTDRNSKDGVEKRPLE and contains various functional domains. When expressed recombinantly, it's often tagged (such as with N-terminal 10xHis-tag) to facilitate purification and detection in experimental settings .

Where is HPH2 localized in yeast cells and how can this be visualized?

HPH2 is localized to the endoplasmic reticulum (ER) membrane. It is a tail-anchored integral membrane protein that colocalizes with its homolog HPH1 in the ER .

For visualization, researchers can use:

• Fluorescent protein tagging (GFP or other fluorescent proteins fused to HPH2)

• Immunofluorescence with specific antibodies against HPH2

• Subcellular fractionation followed by Western blotting

When studying localization, it's important to note that calcineurin can modify the distribution of Hph1p within the ER, and this may influence experimental observations of HPH2 as well due to their interaction .

What is the relationship between HPH1 and HPH2?

HPH1 (YOR324C) and HPH2 (YAL028W) are homologous proteins that serve redundant functions in yeast cells. Key aspects of their relationship include:

• Both are tail-anchored integral ER membrane proteins

• They interact with each other, as demonstrated through yeast two-hybrid assays

• They colocalize to the endoplasmic reticulum

• They serve redundant roles in promoting growth under stress conditions (high salinity, alkaline pH, and cell wall stress)

• Despite their functional redundancy, they differ in their regulation: Hph1p is regulated by calcineurin through dephosphorylation, while Hph2p neither interacts with nor is dephosphorylated by calcineurin

How does HPH2 contribute to stress response in yeast?

HPH2, together with HPH1, is required for yeast survival under various environmental stress conditions. Experimental evidence indicates they promote growth under:

• High salinity conditions

• Alkaline pH environments

• Cell wall stress situations

To study HPH2's role in stress response, researchers can employ the following methodological approaches:

• Generate single (hph2Δ) and double (hph1Δ hph2Δ) deletion mutants

• Subject these mutants to various stress conditions (e.g., different salt concentrations, pH levels, cell wall-disrupting agents)

• Measure growth rates, cell morphology, and survival rates

• Complement mutants with wild-type or modified HPH2 to determine functional domains

• Analyze gene expression changes in response to stress in wild-type vs. mutant strains

When designing such experiments, it's important to note that single deletion of either HPH1 or HPH2 may not produce strong phenotypes due to their functional redundancy .

What is the relationship between HPH2 and calcineurin signaling?

While HPH1 is a direct substrate of calcineurin and contains a PVIAVN motif that serves as a calcineurin docking site, HPH2 neither interacts with nor is dephosphorylated by calcineurin . This presents an interesting research question about how these homologous proteins have diverged in their regulation.

Methodological approaches to study this relationship include:

• Phosphorylation state analysis of HPH1 and HPH2 in wild-type and calcineurin-deficient strains

• Domain swapping between HPH1 and HPH2 to identify regions responsible for calcineurin interaction

• Epistasis analysis using various combinations of hph1Δ, hph2Δ, and calcineurin pathway mutants

Research has shown that HPH1/HPH2 and CRZ1 (a transcription factor downstream of calcineurin) act in distinct pathways downstream of calcineurin, indicating multiple branches in the calcineurin signaling network .

How can recombinant HPH2 protein be optimally produced and purified?

For researchers working with recombinant HPH2, optimal expression and purification strategies are crucial. Based on established protocols:

• Expression system: In vitro E. coli expression systems have been successfully used for HPH2 production

• Construct design:

  • Full-length protein (1-528 amino acids) with N-terminal 10xHis-tag

  • Include appropriate linker sequences

• Purification conditions:

  • Use Tris/PBS-based buffer, pH 8.0

  • Include 6% Trehalose as a stabilizing agent

• Storage:

  • Store at -20°C/-80°C upon receipt

  • Aliquot for multiple use to avoid freeze-thaw cycles

  • Lyophilized form has a longer shelf life (approximately 12 months) compared to liquid form (approximately 6 months)

When working with membrane proteins like HPH2, solubilization with appropriate detergents may be necessary to maintain protein structure and function.

What experimental designs are appropriate for studying HPH2 function in vivo?

When designing experiments to study HPH2 function, researchers should consider several key approaches:

• Completely Randomized Design: This approach is useful for initial phenotypic characterization. For example, randomly assigning yeast strains (wild-type, hph2Δ, hph1Δ, and hph1Δ hph2Δ) to different treatment conditions (normal growth, high salt, alkaline pH) .

• Randomized Block Design: This design can help control for confounding variables. For instance, blocking by yeast strain background or growth conditions to eliminate strain-specific effects .

• Matched Pairs Design: Particularly useful when studying genetic interactions. For example, comparing the effects of HPH2 deletion in wild-type vs. calcineurin-deficient backgrounds .

How can researchers investigate HPH2 interactions with the Sec63/Sec62 complex?

Recent research has identified that HPH1 and HPH2 are novel components of the Sec63/Sec62 complex . To investigate these interactions, researchers can employ:

• Co-immunoprecipitation assays: Using TAP-tagged Sec proteins to pull down HPH2 or vice versa

• Yeast two-hybrid analysis: To map specific interaction domains

• Fluorescence microscopy: To visualize colocalization of HPH2 with Sec complex components

• Functional complementation: Testing whether Sec complex mutants can be rescued by HPH2 overexpression

A methodological approach used in previous research involved:

• Creating heterozygous SEC-TAP/SEC diploid strains

• Transforming these strains with HPH2-containing plasmids (such as pFJP13, pFJP14, or pFJP20)

• Analyzing protein interactions through affinity purification and mass spectrometry

How should researchers interpret phenotypic data from HPH2 mutants?

When analyzing phenotypic data from HPH2 mutants, several considerations are essential:

• Redundancy effects: Due to the functional redundancy between HPH1 and HPH2, single mutants may show mild or no phenotypes. Double mutants (hph1Δ hph2Δ) typically exhibit stronger phenotypes under stress conditions .

• Heterozygosity considerations: If using heterozygous strains, recombination frequencies may need to be adjusted. For example, if strains are heterozygous for the hph2 locus, the actual stimulation of homologous recombination might be twice as much as found experimentally .

• Statistical analysis: When comparing growth rates or stress tolerance, appropriate statistical tests should be employed. For intrachromosomal recombination experiments, careful calculation of frequencies based on the number of resistant colonies divided by regeneration frequency is necessary .

What are the considerations for studying HPH2's role in homologous recombination?

Some research suggests a potential role for HPH-related processes in recombination. When studying this aspect:

• Calculate recombination frequency by dividing the number of recombinant events by the total number of cells analyzed

• For heterozygous strains, account for the gene dosage effect (as mentioned above)

• Consider that intramolecular homologous recombination may occur through various combinations of recombination events

• When analyzing data, note that restoration of functional genes must have occurred by intramolecular homologous recombination in heterozygous contexts

What are the unresolved questions about HPH2 function?

Despite significant advances in understanding HPH2, several research gaps remain:

• The precise molecular mechanism by which HPH2 contributes to stress tolerance

• The evolutionary conservation of HPH2 function across fungal species

• Whether HPH2 has any enzymatic activity similar to its human homolog EGLN1/PHD2

• The complete interactome of HPH2 in different stress conditions

• The potential role of HPH2 in protein trafficking through the ER membrane

How does yeast HPH2 compare to mammalian PHD2/EGLN1?

Interestingly, the term HPH2 is also used for a mammalian protein called Prolyl Hydroxylase Domain-containing protein 2 (PHD2, also known as EGLN1 and HIF-PH2). Although they share a name, the functions appear distinct:

• Mammalian PHD2/HPH2 is a 45-47 kDa dioxygenase that regulates hypoxia-inducible factor (HIF)

• It requires oxygen for its activity and thus serves as a cellular oxygen sensor

• The human protein contains different domains than the yeast version, including an NES, a Zn-finger region, and a catalytic domain

• Human PHD2 undergoes post-translational modifications including nitrosylation of cysteines and acetylation

Researchers studying the yeast protein should be careful not to confuse it with the mammalian protein in literature searches and experimental design.