Recombinant Saccharomyces cerevisiae Protein ILM1 (ILM1)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Pathways

ILM1 is implicated in:

  • Mitochondrial DNA Maintenance: Required for stability of mitochondrial DNA under stress .

  • Filamentous Growth: Induced during slowed DNA synthesis or nutrient limitation .

  • Protein Interactions: Associates with VPS65, a putative vacuolar protein sorting factor .

Functional PartnerRoleInteraction Score
VPS65Vacuolar protein sorting; anaerobic growth0.609 (STRING-db)

Expression and Purification

  • Expression System: Optimized in E. coli for high yield . Codon bias is addressed via rare tRNA supplementation, a method validated for yeast mitochondrial proteins .

  • Purification: Immobilized metal affinity chromatography (IMAC) leveraging the His tag .

Quality Assurance

  • Purity Analysis: Validated by SDS-PAGE .

  • Stability: Lyophilization with trehalose prevents aggregation; glycerol (5–50%) extends shelf life .

Research Applications

  • Mitochondrial Studies: Used to investigate DNA loss mechanisms under oxidative stress .

  • Protein Interaction Mapping: Screened via yeast two-hybrid systems to identify partners like VPS65 .

  • Structural Biology: Serves as a substrate for crystallization trials due to high purity .

Comparative Analysis Across Species

ILM1 homologs exist in other fungi, with varying lengths and roles:

SpeciesProtein LengthFunction
S. cerevisiae (S288c)203 aaMitochondrial DNA stability
Schizosaccharomyces pombe161 aaUncharacterized

Limitations and Future Directions

  • Functional Gaps: The exact biochemical mechanism in mitochondrial DNA maintenance remains unresolved .

  • Industrial Potential: Engineering ILM1 fusion partners (e.g., TFPs for secretory pathways) could enhance recombinant yields .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format we have in stock. However, if you require a specific format, please specify your preference when placing your order, and we will fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ILM1; YJR118C; J2033; Protein ILM1; Increased loss of mitochondrial DNA protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
ILM1
Target Protein Sequence
MAQALNSTNIAFFRVAFLFTIAFFCLKNVNSILQNTYFIVLTQAMNLPQLTLSRYSGQLG LFALLFTLNGVHDLIPLLENNVKYFQSVVPVRLLIFFILTSISYLWESNFYVHNNSVFIY CFAEVWINFLLYNAIREEKNEEFKRLNQFMVNDEDIEEPQPFTVKTETTEIIEIINDEEN DDEDGKDNDDNNEKGNDDSDAKK
Uniprot No.

Target Background

Database Links

KEGG: sce:YJR118C

STRING: 4932.YJR118C

Protein Families
ILM1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is ILM1 and what genomic information is available?

ILM1 (encoded by the ILM1 locus S000003879) is a protein in Saccharomyces cerevisiae. According to the Saccharomyces Genome Database, researchers can access its complete DNA sequence, protein sequence, genomic context, and coordinates through the database. The SGD provides multiple bioinformatic tools including BLASTN, BLASTP, primer design capabilities, restriction mapping, and six-frame translation for comprehensive analysis of this gene .

For in-depth sequence analysis, researchers should utilize both basic BLAST searches against the S. cerevisiae reference genome as well as extended comparisons against other fungal species to identify conserved domains and evolutionary relationships.

What expression systems are most effective for recombinant yeast proteins like ILM1?

For high-yield expression of recombinant proteins in S. cerevisiae, the selection of appropriate expression vectors is critical. Research indicates that POT1-based expression systems offer significant advantages:

Expression VectorKey FeaturesAdvantagesYield Comparison
CPOTud vectorPOT1 marker, TPI1 promoter>10-fold higher production vs. standard vectorsSuperior for high expression requirements
POTud plasmidPOT1 marker, TEF1 promoterHigh plasmid stability in rich mediaGood for standard expression needs
p426GPDURA3 marker, GPD promoterTraditional system, well-characterizedLower yields than POT1-based systems

The POT1-based systems have demonstrated exceptional performance because they maintain high plasmid stability even when strains are cultivated in rich medium, generating higher cell numbers and protein production compared to traditional auxotrophy-based systems .

How do different promoters affect protein expression kinetics in yeast?

Promoter selection significantly impacts not only expression levels but also production kinetics throughout different growth phases:

PromoterExpression CharacteristicsGrowth Phase PerformanceBest Applications
TEF1Strong, constitutive expressionHigh expression in both glucose-rich and glucose-limited conditionsWhen consistent expression is needed
TPI1Strong glycolytic gene promoterHigher performance during glucose metabolismFor proteins better expressed during active growth
GPDConstitutive, glycolytic enzymeGeneral high expressionStandard expression applications

Research has demonstrated that expression kinetics change during diauxic shift. For example, insulin precursor shows higher production rate during glucose uptake phase, while amylase shows higher production during ethanol uptake phase . This phase-dependent expression pattern should be considered when designing ILM1 expression strategies.

What leader sequences optimize secretion of recombinant proteins in yeast?

Leader sequence selection is crucial for efficient protein secretion. Two widely-studied leader sequences provide distinct advantages:

Leader SequenceCharacteristicsAdvantagesConsiderations
Alpha factor leaderContains three glycosylation sitesSuccessfully increases protein secretion for many proteinsMay result in hyperglycosylation
Synthetic leader (Yap3-TA57)No glycosylation sitesEnsures high secretion levels; avoids glycosylation issuesPreferred for non-glycosylated proteins

The alpha factor leader from S. cerevisiae has been proven to successfully increase protein secretion levels in numerous cases. In contrast, the synthetic leader Yap3-TA57 contains no glycosylation sites and has demonstrated high secretion efficiency for proteins like insulin precursor .

When expressing ILM1, researchers should consider testing both leader sequences to determine which provides optimal expression based on protein characteristics and experimental requirements.

What cloning strategies are recommended for recombinant yeast protein expression?

Based on established methodologies for yeast protein expression, an effective cloning strategy involves:

  • Gene amplification from genomic DNA using high-fidelity polymerase

  • Insertion of KOZAK sequence (aacaaa) before the secretion leader to enhance translation efficiency

  • Addition of Kex2 site (aaaaga) and spacer (gaagaaggtgaaccaaaa) between leader and protein coding sequence to improve leader cleavage

  • Incorporation of appropriate restriction sites for flexible vector construction

  • Selection of appropriate vector backbone with optimal marker system

For yeast genomic DNA isolation, methods such as the Qiagen Genomic Tip-100 Kit provide high-quality template for PCR amplification . The use of a nested PCR approach can improve specificity when amplifying from genomic templates .

How can nucleic acid preparation be optimized for yeast recombinant expression?

Proper nucleic acid preparation is essential for successful cloning and expression:

  • Genomic DNA isolation: For S. cerevisiae strains like INVSc1, use of specialized kits (Qiagen Genomic Tip-100 Kit) ensures high-quality template DNA

  • Vector preparation: Plasmid isolation from E. coli (using Qiagen Midi-Prep Kit) following amplification with appropriate antibiotics

  • Restriction digestion: Sequential digestion with high-fidelity restriction enzymes followed by gel purification

  • PCR optimization: Use of high-fidelity polymerases for gene amplification with optimized annealing temperatures

  • Primer design: Incorporation of appropriate restriction sites, leader sequences, and fusion tags

These methods have been successfully applied for expression of other yeast proteins and provide a foundation for ILM1 expression work .

How can protein structure prediction tools inform ILM1 research?

Modern computational approaches have revolutionized protein structure prediction, with important implications for ILM1 research:

The AlphaFold system developed by Google's DeepMind has created a comprehensive database of protein structures, including over 350,000 proteins from 20 organisms that scientists rely on for research. This AI-based system was trained on 170,000 known protein structures and can accurately predict the shape of proteins based on their amino acid sequences, achieving accurate predictions for 58% of human proteins .

For ILM1 research, these computational models can:

  • Provide structural insights without requiring crystallization

  • Identify potential functional domains

  • Guide rational design of mutations for structure-function studies

  • Inform protein-protein interaction studies

  • Assist in designing stabilizing modifications

The transformative nature of these prediction tools has fundamentally changed biological research, making structural information more accessible even for challenging proteins .

What experimental approaches can characterize post-translational modifications of ILM1?

Post-translational modifications, particularly glycosylation, significantly impact protein function and stability. For characterizing modifications in recombinant ILM1:

  • Glycosylation analysis:

    • Enzymatic deglycosylation with endoglycosidases followed by SDS-PAGE mobility shift analysis

    • Mass spectrometry to identify specific glycan structures

    • Comparison of expression with glycosylation-competent (alpha factor) versus non-glycosylating (Yap3-TA57) leader sequences

  • Phosphorylation analysis:

    • Phospho-specific staining or antibody detection

    • Mass spectrometry following phosphopeptide enrichment

    • Expression in phosphatase-deficient strains

S. cerevisiae expression often results in hyperglycosylation of proteins. Leader sequences are sometimes mutated and selected to reduce the amount of unprocessed and hyper-glycosylated proteins, as well as to more efficiently direct proteins through the secretory pathway .

How can protein secretion levels be enhanced in S. cerevisiae expression systems?

Enhancement of recombinant protein secretion can be achieved through multiple complementary approaches:

Enhancement StrategyMechanismImplementation ApproachExpected Outcome
Host strain engineeringImprove cellular machineryOverexpress folding chaperonesReduces misfolded protein
Overexpress trafficking proteinsEnhances secretory pathway efficiency
Reduce proteolysisIncreases protein yield
Expression system optimizationMaximize gene expressionModify protein coding sequencesImproves translation efficiency
Optimize signal sequencesEnhances secretion targeting
Increase plasmid copy numberRaises gene dosage
Leader sequence engineeringImprove protein processingUse modified alpha factor leaderReduces hyperglycosylation
Select synthetic leaders without glycosylation sitesControls post-translational modifications

These strategies have demonstrated success in enhancing secretion of various recombinant proteins in yeast systems and can be applied systematically to optimize ILM1 expression.

What media formulations and growth conditions optimize recombinant protein expression in yeast?

Growth conditions significantly impact recombinant protein yields in S. cerevisiae. Based on established protocols:

  • Media selection:

    • Rich media (YPD: 20 g/L glucose, 10 g/L yeast extract, 20 g/L peptone, 1 g/L BSA) provides high cell density and is compatible with POT1-based expression systems

    • Synthetic media is required for auxotrophy marker expression systems but yields lower cell numbers

  • Growth parameters:

    • Temperature: Standard growth at 30°C, but lower temperatures (20-25°C) may improve folding of complex proteins

    • pH: Maintaining pH 5.5-6.0 often improves protein stability

    • Aeration: High aeration levels support biomass production and protein synthesis

  • Induction strategy:

    • For constitutive promoters (TEF1, GPD), no induction is required

    • For regulated promoters, specific induction protocols must be followed

The POT1 expression systems have distinct advantages as they maintain high plasmid stability even in rich media, which can generate higher cell numbers and higher protein production compared to auxotrophy-based systems that require synthetic media .

How do different host organisms compare for recombinant expression of yeast proteins?

When considering expression of yeast proteins like ILM1, multiple host organisms provide distinct advantages:

Host OrganismAdvantagesLimitationsBest Applications
S. cerevisiaeNative environment, proper foldingLower yields than other systemsWhen authentic modifications are essential
Pichia pastorisHigher expression, less hyperglycosylationDifferent glycosylation patternHigh-yield secreted proteins
Escherichia coliHighest yields, simplest systemNo glycosylation, folding issuesSimple proteins, inclusion body refolding

For yeast membrane carrier proteins, researchers have undertaken recombinant expression in S. cerevisiae, P. pastoris, and E. coli, optimizing expression level and refolding to support direct biochemical characterization . This multi-system approach can be applied to ILM1 to determine the optimal expression host.

How do different strain backgrounds affect recombinant protein expression in S. cerevisiae?

Strain selection has significant impacts on expression outcomes:

  • Laboratory strains (e.g., S288C, CEN.PK): Well-characterized genomic background, optimal for fundamental research

  • Protease-deficient strains: Reduce protein degradation, increasing yield of sensitive proteins

  • Chaperone-overexpressing strains: Improve folding of complex proteins

  • Glycosylation-modified strains: Provide humanized or reduced glycosylation patterns

Through strategic selection of strain background, expression vector, leader sequence, and culture conditions, researchers can optimize recombinant production of ILM1 for structural and functional characterization.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.