Recombinant Saccharomyces cerevisiae Protein LOH1 (LOH1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Protein LOH1

Loss of heterozygosity (LOH) is a genetic event where one allele of a gene is lost, leading to a hemizygous or homozygous state . In Saccharomyces cerevisiae, LOH can occur through mitotic recombination, which is particularly important in organisms with infrequent meiosis . The LOH1 protein, specifically in its recombinant form produced in S. cerevisiae, is relevant in the context of genetic stability and diversity within this yeast species .

Genetic Background of LOH in Saccharomyces cerevisiae

S. cerevisiae exhibits high levels of inbreeding and infrequent sexual cycles, impacting genome variation and heterozygosity patterns . A significant proportion of natural isolates are heterozygous, with variations across subpopulations and differences between domesticated and wild clades . LOH events in S. cerevisiae range from a few to many regions per strain, potentially covering a substantial portion of the genome . These events are not evenly distributed, with centromere-proximal regions showing fewer LOH events . LOH contributes to genetic diversity by enabling the expression of recessive alleles and generating novel allele combinations, which can affect phenotypic diversity .

Role of IRC20 in Modulating LOH

IRC20, a putative helicase and E3 ubiquitin ligase involved in the DNA double-strand break repair pathway, influences LOH frequency and distribution . Deletion of IRC20 results in a small but statistically significant enhancement of LOH . Specifically, both short and long LOH tracts are enhanced in irc20Δ mutants, with LOH events being more telomere-proximal and away from centromeres compared to wild type . IRC20 primarily regulates mitotic recombination without affecting meiotic crossovers, highlighting its importance in maintaining genome stability .

Recombinant Protein Production in Saccharomyces cerevisiae

S. cerevisiae is used for producing recombinant therapeutic proteins, and advancements in yeast synthetic biology have enhanced its capabilities in this area . The yeast protein secretory pathway involves approximately 200 proteins responsible for the translation, modification, and secretion of proteins . Overexpression of certain genes such as SEC65, MNS1, SWA2, ERV2, and ERO1 can significantly increase recombinant protein production rates . For example, Sec65, a subunit of the signal recognition particle (SRP), facilitates protein translocation to the endoplasmic reticulum (ER), while Mns1 aids in folding and ER-associated degradation (ERAD) . ERO1, a thiol oxidase, is essential for oxidative protein folding in the ER and has been identified as a target for enhancing secretory protein production .

Strategies to Enhance Recombinant Protein Secretion

Several strategies can improve the secretion of recombinant proteins in S. cerevisiae, including manipulating the ER luminal environment by overexpressing protein-folding factors and redox enzymes . Overexpression of chaperones like SIL1, LHS1, JEM1, SCJ1, KAR2, ERO1, and PDI1 can enhance secretion capacities . Additionally, the unfolded protein response (UPR) and ERAD pathways play crucial roles in protein flux through the ER-to-Golgi apparatus .

GAL1 Promoter and its Applications

The GAL1 promoter is commonly used for recombinant protein production in S. cerevisiae, although it has limitations such as galactose consumption and high cost . Modifications to the GAL1 promoter, such as incorporating Zif268 binding sites, have enabled more sensitive control of gene expression using synthetic transcription factors .

Molecular Mechanisms of Inhibitors in Magnaporthe oryzae

Studies involving inhibitors like compound C1 in Magnaporthe oryzae provide insights into gene expression and molecular mechanisms . Transcriptomic profiling reveals significant differences in mRNA expression between treated and control groups, with approximately equal proportions of up-regulated and down-regulated mRNAs . Genes such as cytochrome P450, glycylpeptide N-myristoyltransferase (NMT), and peroxisomal membrane protein 4 are significantly affected .

C1 Inhibitory Effects on Phytopathogens

PhytopathogenInhibition Ratio at 20 μg/mLEC50 Index at 20 μg/mL
R. solani100%1.20
B. maydis60-80%N/A
S. scleotiorum60-80%N/A
M. orzae60-80%N/A
G. zeae60-80%N/A
B. cintrea60-80%N/A

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your application.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
LOH1; OSW4; YJL038C; J1232; Outer spore wall protein 4; Loss of heterozygosity protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
LOH1
Target Protein Sequence
MRFQLFIYFYFTIVVIAGTNTIQQFSDAGDRLITSLRNLDNNGTYETLTAEKVPIIEGQI QNISAKYEQHTFILKGLEAVLNYKVKSLDNNERESLEIEYEKVEKALDAALNVSPFEYIK KFKEVSRGKVVNALENLSREQNRITINGGREDEKEKEAREKKKRLDRIKRILTVSLLELG LAQGVADLCAVAPFACLLGVTVGSIGFIFWLALIYNAIQ
Uniprot No.

Target Background

Function
LOH1 is involved in spore wall assembly and may contribute to maintaining genome integrity.
Database Links

KEGG: sce:YJL038C

STRING: 4932.YJL038C

Protein Families
OSW4/6 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Loss of Heterozygosity (LOH) in the context of S. cerevisiae?

Loss of Heterozygosity (LOH) refers to genetic events during vegetative growth and reproduction of diploid yeast cells that result in the conversion of heterozygous loci to homozygosity. In S. cerevisiae, LOH can occur through several molecular mechanisms, including mitotic crossovers, gene conversion, and DNA synthesis repair triggered by double-strand breaks . LOH is observed during normal mitotic growth of diploid yeast and can affect regions ranging from single genes to entire chromosomes. This phenomenon represents a significant source of genetic variation in diploid yeast populations, particularly in strains with high levels of heterozygosity .

What are the primary mechanisms that drive LOH in yeast?

LOH in S. cerevisiae occurs through several distinct mechanisms:

  • Gene conversion: This represents the most common mode of LOH (approximately 51% of cases), involving the unidirectional transfer of genetic information from one homologous chromosome to another .

  • Mitotic crossing over: This can occur through break-induced replication (BIR) or resolution of double Holliday junctions, leading to reciprocal exchange of genetic material between homologous chromosomes .

  • DNA repair processes: Double-strand breaks trigger repair mechanisms that can lead to LOH through synthesis-dependent strand annealing or other repair pathways .

  • Mitotic recombination: An unavoidable byproduct of DNA repair during growth or reproduction of diploid genotypes that can lead to LOH .

Notably, the search results indicate no evidence that LOH in laboratory settings involves nondisjunction of whole chromosomes .

How prevalent is LOH in natural and laboratory yeast populations?

LOH is extremely common in both natural and laboratory populations of S. cerevisiae. Genome resequencing studies of diverse strains reveal LOH signatures in essentially all examined strains . In laboratory evolution experiments, LOH events occur at a substantial rate, with one study observing an average of 5.2 LOH events per clone after approximately 500 generations . The ubiquity of large LOH regions among heterozygous strains is consistent with long periods of clonality predicted by the facultative asexuality hypothesis, with estimates suggesting between 12,500 to 62,500 clonal generations since outcrossing in some strains .

How does LOH contribute to adaptive evolution in yeast?

LOH plays a crucial role in the adaptive evolution of S. cerevisiae through several mechanisms:

  • Exposure of recessive beneficial alleles: LOH can reveal recessive beneficial mutations that were previously masked in heterozygous state, providing fitness advantages in selective environments .

  • Resolution of negative epistasis: LOH can alleviate negative interactions between alleles at heterozygous loci, such as Dobzhansky–Muller incompatibilities between divergent genotypes .

  • Parallel adaptation: Studies have observed parallel LOH events across replicate populations, occurring in both environment-specific and environment-independent manners, suggesting adaptive significance .

  • Fitness advantage: Experimental evidence has demonstrated that specific LOH events can confer substantial fitness advantages. For example, one study showed that a single LOH event involving the ENA salt efflux pump locus on chromosome IV provided a 27% fitness advantage .

These mechanisms make LOH a potentially greater source of initial variation for rapid evolution than de novo mutation in diploid yeast genotypes .

What is the relationship between LOH and life-history trade-offs in S. cerevisiae?

Research has uncovered a fascinating relationship between genomic heterozygosity (which can be affected by LOH) and life-history trade-offs in S. cerevisiae:

  • Sexual vs. asexual reproduction trade-off: Variation in heterozygosity among strains correlates with how readily yeast switch from asexual to sexual reproduction under nutrient stress. This trade-off manifests as a negative relationship between sporulation efficiency and pseudohyphal development .

  • Gene expression regulation: This trade-off correlates with variation in the expression of RME1, a transcription factor with pleiotropic effects on meiosis and filamentous growth. RME1 serves as a repressor of meiosis but positively regulates invasive growth .

  • Allelic effects: Polymorphisms in the RME1 promoter region affect its expression. Strains homozygous for the S288c allele or heterozygous (S288c/SK1) show approximately threefold higher mean RME1 expression than strains homozygous for the SK1 allele, with corresponding differences in sporulation efficiency .

  • Environmental adaptation: Selection for alternate life-history strategies in natural versus human-associated environments likely contributes to differential maintenance of genomic heterozygosity through its effect on the frequency of sexual cycles and thus the opportunity for inbreeding .

How does parallel LOH contribute to adaptation in different environments?

Parallel LOH events provide strong evidence for adaptive evolution in S. cerevisiae. Research has shown that:

  • Environment-specific patterns: Certain LOH events occur repeatedly in specific environments, suggesting they confer environment-specific adaptive advantages .

  • Environment-independent patterns: Some LOH events occur across multiple environments, indicating they may provide general fitness benefits regardless of specific selective pressures .

  • Existing variation utilization: LOH largely involves recombining existing variation between parental genotypes, though it can also expose de novo beneficial mutations, as observed in the presence of selective agents like canavanine (a toxic analog of arginine) .

  • Specific adaptive loci: For example, repeated LOH events at the ENA salt efflux pump locus on chromosome IV have been observed, with the European parent allele (originally derived by introgression from S. paradoxus) being consistently selected. CRISPR-engineered LOH demonstrated this single event provided a 27% fitness advantage .

What techniques are most effective for detecting and characterizing LOH events in yeast genomes?

Several complementary techniques are used to detect and characterize LOH events in S. cerevisiae:

  • Genome resequencing: Whole-genome sequencing of individual clones allows for comprehensive detection of LOH events across the genome. This approach has been used to identify an average of 5.2 LOH events per clone after ~500 generations .

  • Quantitative PCR (qPCR): Used to measure allele-specific expression changes that may result from LOH. For example, qPCR has been employed to measure RME1 expression differences between strains with different allelic combinations at the RME1 promoter .

  • CRISPR-engineered LOH: This approach allows researchers to artificially induce specific LOH events and measure their fitness consequences. Using this technique, researchers demonstrated that a single LOH event at the ENA locus provided a 27% fitness advantage .

  • Experimental evolution: Growing replicate populations under controlled conditions for hundreds of generations, followed by genome sequencing, enables researchers to identify parallel LOH events that likely confer adaptive advantages .

  • Statistical modeling: Logistic regression models can be used to analyze relationships between LOH, gene expression, and phenotypic traits, as demonstrated in the analysis of RME1 expression and its correlation with sporulation efficiency and pseudohyphal growth .

How can researchers design experiments to distinguish adaptive from neutral LOH events?

Distinguishing adaptive from neutral LOH events requires carefully designed experimental approaches:

  • Parallel evolution analysis: If the same LOH event occurs independently in multiple replicate populations exposed to the same selective pressure, it strongly suggests adaptive significance .

  • Fitness assays: Direct measurement of the fitness consequences of specific LOH events, either through competition assays or growth rate analysis, can quantify their adaptive value. CRISPR-engineered LOH provides a powerful approach for such experiments .

  • Environment-specific versus environment-independent patterns: Comparing LOH events across different selective environments can help distinguish generally beneficial LOH events from those that provide environment-specific advantages .

  • Phenotypic characterization: Correlating LOH events with specific phenotypic changes, such as sporulation efficiency or pseudohyphal growth, can provide insights into their functional consequences .

  • Molecular clock analysis: Using the number of LOH regions in each strain and published estimates of rates of mitotic recombination to estimate the number of clonal generations can help understand the temporal dynamics of LOH events .

How should long-term evolution experiments be designed to study LOH dynamics?

Effective experimental designs for studying LOH dynamics in S. cerevisiae include:

  • Selection of appropriate ancestral strains: Using highly heterozygous diploid strains provides more opportunities to observe LOH events. The search results describe studies using heterozygous diploid isolates of S. cerevisiae .

  • Replicate population structure: Maintaining multiple replicate populations under identical conditions enables identification of parallel LOH events, which strongly indicate adaptive significance .

  • Environmental conditions: Testing multiple environments with different selective pressures helps distinguish environment-specific from environment-independent LOH events. Studies have observed both types of parallel LOH .

  • Temporal sampling: Periodic sampling and sequencing throughout the experiment allows tracking of LOH dynamics over time, including the order of events and potential interactions between multiple LOH events.

  • Control populations: Maintaining populations under non-selective conditions provides a baseline for distinguishing selective from neutral LOH events.

  • Sample size considerations: Genome resequencing of numerous clones (e.g., 70 clones as in one study) provides statistical power to identify patterns in LOH events .

What approaches can be used to directly test the fitness effects of specific LOH events?

Several experimental approaches can directly test the fitness effects of specific LOH events:

  • CRISPR-engineered LOH: Using CRISPR-Cas9 to precisely engineer specific LOH events in otherwise isogenic backgrounds allows direct measurement of their fitness consequences. This approach demonstrated a 27% fitness advantage for a single LOH event at the ENA locus .

  • Competition assays: Directly competing strains with and without specific LOH events in mixed cultures provides a sensitive measure of relative fitness.

  • Growth rate analysis: Comparing growth parameters (lag phase, doubling time, maximum density) between strains with and without specific LOH events can quantify physiological effects.

  • Stress resistance assays: Testing resistance to various stressors (temperature, oxidative stress, nutrient limitation) can reveal condition-specific advantages conferred by LOH events.

  • Transcriptomic analysis: RNA sequencing can identify gene expression changes resulting from LOH events, providing insights into their molecular mechanisms.

How can researchers accurately measure rates of different types of LOH events?

Accurate measurement of LOH rates requires specialized experimental approaches:

  • Genome-wide sequencing: Whole-genome resequencing of multiple clones after a known number of generations allows calculation of LOH rates across the genome .

  • Classification of LOH mechanisms: Detailed analysis of sequence data can distinguish between different LOH mechanisms. For example, one study found that gene conversion accounted for 51% of LOH events, with the remainder attributed to crossing over consistent with either break-induced replication or double Holliday junction resolution .

  • Marker-based systems: Using selectable or screenable markers at specific loci can facilitate high-throughput detection of LOH events, though this approach provides less comprehensive information than genome-wide sequencing.

  • Fluctuation analysis: Applying the Luria-Delbrück fluctuation test methodology to LOH events can distinguish between pre-existing and newly arising events.

  • Molecular clock approaches: Using the number of LOH regions and published estimates of mitotic recombination rates to estimate the number of clonal generations since outcrossing .

What statistical approaches are most appropriate for analyzing parallel LOH events?

Several statistical approaches are useful for analyzing parallel LOH events:

  • Enrichment analysis: Testing whether specific genomic regions experience LOH events more frequently than expected by chance across replicate populations.

  • Logistic regression models: These can be used to analyze relationships between LOH events, gene expression, and phenotypic traits. For example, logistic regression has been used to analyze how RME1 expression predicts sporulation efficiency and pseudohyphal growth .

  • Permutation tests: These can establish the statistical significance of parallel LOH events by comparing observed patterns to randomized data.

  • Bayesian approaches: These can incorporate prior knowledge about recombination rates and selective pressures to interpret observed LOH patterns.

  • Classification of LOH mechanisms: Statistical analysis can quantify the relative frequencies of different LOH mechanisms, such as gene conversion (51% of events) versus crossing over .

How can researchers distinguish between selection on pre-existing variation versus de novo mutations in LOH studies?

Distinguishing selection on pre-existing variation versus de novo mutations requires careful analytical approaches:

  • Origin of homozygous alleles: If LOH events consistently favor the same parental allele across replicate populations, this suggests selection on pre-existing variation. For example, repeated LOH to the European parent allele at the ENA locus indicates selection on pre-existing variation .

  • Timing of LOH events: Early LOH events in evolution experiments are more likely to involve pre-existing variation, while later events may involve de novo mutations.

  • Selective environments: In strong selective environments, LOH may expose recessive beneficial mutations that arise de novo, as observed in the presence of canavanine .

  • Sequence analysis: Detailed examination of the sequences involved in LOH events can reveal whether they match pre-existing parental alleles or contain novel mutations.

  • Environmental independence: LOH events that occur across multiple different environments are more likely to involve generally beneficial pre-existing variation rather than environment-specific de novo mutations .

What are the most promising areas for future research on LOH in S. cerevisiae?

Several promising research directions emerge from current understanding of LOH in S. cerevisiae:

  • Molecular mechanisms of LOH regulation: Further investigation into how cells regulate mitotic recombination rates and whether these rates can evolve in response to selection pressures.

  • Interaction between LOH and other evolutionary mechanisms: Exploring how LOH interacts with de novo mutation, horizontal gene transfer, and sexual reproduction in shaping yeast genome evolution.

  • Environmental triggers of LOH: Identifying environmental factors that might increase or decrease LOH rates and their potential adaptive significance.

  • LOH and genome stability: Understanding the relationship between LOH, genome stability, and adaptation to fluctuating environments.

  • Application to synthetic biology: Harnessing controlled LOH to create genetic diversity in engineered yeast strains for biotechnological applications.

  • Additional genetic loci involved in life-history trade-offs: Identifying genetic loci beyond RME1 that contribute to the trade-off between sporulation and pseudohyphal growth, as the search results mention "significant residual variation in both sporulation and pseudohyphal growth ability that is not correlated with RME1 expression" .

How might understanding of LOH in yeast inform studies in other organisms?

Insights from LOH research in S. cerevisiae have broader implications for understanding evolutionary processes in other organisms:

  • Cancer biology: LOH is associated with cancer progression through exposure of recessive mutations, making yeast a valuable model for understanding fundamental mechanisms of LOH that may apply to human cells .

  • Pathogenic fungi: Understanding how LOH contributes to adaptation in yeast can inform studies of antifungal resistance in pathogenic fungi, which often evolve through similar mechanisms .

  • Asexual evolution: Yeast provides a model for understanding how predominantly asexual organisms generate genetic diversity through processes like LOH, with relevance to many unicellular eukaryotes .

  • Life-history evolution: The trade-offs between sexual and asexual reproduction observed in yeast may inform understanding of similar trade-offs in other facultatively sexual organisms .

  • Genome stability mechanisms: Insights into the molecular mechanisms of mitotic recombination in yeast continue to inform understanding of similar processes across eukaryotes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.