Recombinant Saccharomyces cerevisiae Protein MRH1 (MRH1)

Shipped with Ice Packs
In Stock

Description

Molecular Properties

MRH1 protein exhibits several important molecular characteristics that influence its behavior in experimental and physiological contexts. When expressed as a recombinant protein, MRH1 is typically fused with an N-terminal His-tag to facilitate purification and detection . The protein has the following specifications:

PropertyCharacteristic
SpeciesSaccharomyces cerevisiae
Source (Expression System)E. coli
TagHis
Protein LengthFull Length (1-320)
FormLyophilized powder
UniProt IDQ12117
SynonymsMRH1; YDR033W; YD9673.03; Protein MRH1; Membrane protein related to HSP30

The recombinant MRH1 protein demonstrates stability characteristics typical of membrane proteins, requiring careful handling to maintain its structural integrity during experimental procedures .

Functional Role of MRH1 in Yeast Biology

MRH1's designation as a "Membrane protein related to HSP30" provides important clues about its functional significance in yeast cells. HSP30 is a well-characterized integral plasma membrane heat shock protein in Saccharomyces cerevisiae that plays crucial roles in stress response and adaptation .

Relationship to HSP30 and Stress Response

Based on its relationship to HSP30, MRH1 may be involved in cellular responses to various stressors. HSP30 has been shown to be induced by multiple stress conditions, including heat shock, ethanol exposure, severe osmostress, weak organic acid exposure, and glucose limitation . The functional similarity between MRH1 and HSP30 suggests that MRH1 might also participate in these stress response pathways, potentially contributing to yeast adaptation under adverse environmental conditions.

Potential Role in Energy Conservation

One of the significant functions of HSP30 is the downregulation of stress-stimulated plasma membrane H⁺-ATPase activity . This regulatory mechanism is particularly important as plasma membrane H⁺-ATPase consumes a substantial fraction of cellular ATP. By downregulating the ATPase activity during prolonged stress exposure, HSP30 plays an energy conservation role in yeast cells . Given its relationship to HSP30, MRH1 might share similar functions in energy homeostasis, potentially contributing to the efficiency of cellular energy utilization during stress conditions.

Expression and Purification of Recombinant MRH1

The recombinant form of MRH1 protein is typically produced using prokaryotic expression systems, most commonly Escherichia coli. This approach offers advantages in terms of yield, cost-effectiveness, and ease of purification, making it a preferred method for obtaining quantities of the protein sufficient for research purposes .

Expression Systems

While E. coli represents the most commonly used expression system for recombinant MRH1 production, alternative systems might also be considered based on specific research requirements. The choice of expression system can significantly influence protein yield, folding, and post-translational modifications. For transmembrane proteins like MRH1, proper folding and membrane integration can be particularly challenging, necessitating careful optimization of expression conditions .

Reconstitution Protocol

For experimental use, lyophilized MRH1 protein requires proper reconstitution. The recommended protocol involves briefly centrifuging the vial to bring contents to the bottom, followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (5-50% final concentration) is advised for long-term storage at -20°C/-80°C, with 50% being the standard recommendation . This reconstitution approach helps maintain protein stability and functionality for subsequent experimental applications.

Research Applications of Recombinant MRH1

Recombinant MRH1 protein serves as a valuable tool for investigating various aspects of yeast cell biology, particularly in the context of stress response mechanisms and membrane protein function.

Investigation of Stress Response Mechanisms

Given its relationship to HSP30, recombinant MRH1 can be utilized in studies examining stress response pathways in yeast. Experiments using the purified protein might help elucidate its specific roles in various stress conditions, potentially revealing new aspects of cellular adaptation mechanisms. Such research could contribute to our broader understanding of how eukaryotic cells respond to environmental challenges, with potential implications for biotechnological applications and stress-resistant strain development.

Physiological Significance in Yeast Adaptation

Understanding the physiological roles of MRH1 in yeast adaptation to stress conditions provides valuable insights into cellular survival mechanisms under adverse environments.

Growth Adaptation Under Stress

By analogy to HSP30, MRH1 might play a role in facilitating yeast adaptation to growth under stressful conditions. HSP30 has been shown to assist yeast cells in adapting to growth in environments where maintaining homeostasis demands unusually high energy usage . The absence of HSP30 extends the time needed for cells to adapt to such conditions and results in lower biomass yields and ATP levels . If MRH1 shares these functional characteristics, it may similarly contribute to growth adaptation strategies, particularly in contexts requiring efficient energy management.

Implications for Biotechnology Applications

The potential roles of MRH1 in stress response and energy conservation have significant implications for biotechnological applications involving yeast. Understanding these mechanisms could inform strategies for developing stress-resistant yeast strains with enhanced performance in industrial processes such as biofuel production, baking, brewing, and recombinant protein expression. Manipulating MRH1 expression or activity might offer approaches to optimize yeast performance under specific process conditions, potentially improving yield and efficiency in biotechnological applications.

Comparative Analysis with Related Proteins

Examining MRH1 in the context of related proteins provides a broader perspective on its evolutionary and functional significance in yeast biology.

Comparison with HSP30

While MRH1 is characterized as a membrane protein related to HSP30, understanding the precise nature of this relationship requires comparative analysis of their sequences, structures, and functions. HSP30 functions as a downregulator of plasma membrane H⁺-ATPase activity during stress conditions, contributing to energy conservation in yeast cells . The extent to which MRH1 shares these specific functions, or whether it possesses distinct but complementary roles, represents an important area for further investigation.

Evolutionary Conservation

Analysis of MRH1 conservation across different yeast species and potentially in other fungi could provide insights into its evolutionary significance and functional importance. Highly conserved proteins typically play fundamental roles in cellular biology, and the degree of MRH1 conservation might indicate the breadth of its physiological significance across fungal species.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will prepare according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
MRH1; YDR033W; YD9673.03; Protein MRH1; Membrane protein related to HSP30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-320
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MRH1
Target Protein Sequence
MSTFETLIKRGGNEAIKINPPTGADFHITSRGSDWFWTCFCCYLLFGLILTFLMFRKPVN DRFFYLTGIAPNFFMCIAYFTMASNLGWIPVKAKYNHVQTSTQKEHPGYRQIFYSRFVGW FLALPWPIIQICMLAGTPFWQMAFNVCITEFFTVCWLIAACVHSTYKWGYYTIGLGAAIV VSISVMTTSYNLVKQRDNDIRLTFLVFFSIIMFLWIIAYPTCFGITDGGNVLQPDSAGIF YGIIDLILMCFIPTLLVPIANHFGADKLGYHFGPSDAEAVMAPKAPVASPRPAATPNLSK DKKKKSKKSKKSKKSKKSEE
Uniprot No.

Target Background

Gene References Into Functions
  1. Yro2 and Mrh1 are involved in tolerance to acetic acid stress. PMID: 25503505
Database Links

KEGG: sce:YDR033W

STRING: 4932.YDR033W

Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion. Bud. Note=Localized primarily to the plasma membrane. Also found at the buds.

Q&A

What is the primary structure and size of recombinant S. cerevisiae MRH1 protein?

Recombinant full-length Saccharomyces cerevisiae protein MRH1 consists of 320 amino acids (residues 1-320) . When produced with a histidine tag for purification purposes, the protein maintains its full-length sequence while gaining additional histidine residues that facilitate its isolation through affinity chromatography techniques. The His-tag placement is strategically designed to minimize interference with protein function while maximizing purification efficiency.

The protein's primary sequence determines its folding properties, stability characteristics, and functional capabilities. Researchers should consider the implications of the full protein length when designing experiments, as truncated versions may lack critical domains necessary for proper function.

What expression systems are most effective for producing recombinant MRH1?

E. coli represents the predominant expression system for recombinant MRH1 protein production, as evidenced by commercially available preparations . The bacterial expression system offers several advantages for yeast protein production, including:

  • High protein yield through optimized codon usage

  • Straightforward induction protocols using IPTG or other inducers

  • Cost-effective scaled production for research quantities

  • Well-established purification protocols for His-tagged proteins

For optimal expression in E. coli, researchers should consider:

  • Using BL21(DE3) or Rosetta strains to address potential codon bias issues

  • Optimizing induction temperature (typically 18-25°C for improved folding)

  • Testing various induction times (4-16 hours) to maximize soluble protein yield

  • Incorporating protease inhibitors during lysis to prevent degradation

Alternative expression systems may be considered for specific research applications requiring post-translational modifications not available in bacterial systems.

How can researchers functionally characterize MRH1 using yeast-based assays?

Functional characterization of MRH1 can effectively utilize methodologies developed for other yeast proteins. Drawing from approaches used with MMR proteins in S. cerevisiae, researchers can adapt several proven techniques:

  • Yeast two-hybrid (Y2H) assays: Similar to methods used for MLH1-PMS2 interaction studies, Y2H can identify MRH1 binding partners by fusing MRH1 to a DNA binding domain and potential interactors to an activation domain . This approach allows for systematic screening of protein-protein interactions in vivo.

  • Dominant mutator effect assays: Functional variants of MRH1 can be assessed through their effects on cellular phenotypes when expressed in wild-type yeast, similar to approaches used for MLH1 variants . This involves:

    • Expressing MRH1 variants from plasmid vectors

    • Measuring mutator phenotypes through appropriate reporter systems

    • Quantifying functional impacts through comparative growth assays

  • DHFR protein-fragment complementation assay (PCA): This technique measures protein abundance and stability in vivo, as demonstrated with MLH1 variants . By fusing MRH1 to one fragment of murine DHFR and monitoring methotrexate resistance, researchers can quantitatively assess protein stability parameters.

What approaches can effectively analyze MRH1 variants and their functional impact?

For comprehensive analysis of MRH1 variants, researchers should implement multi-faceted experimental approaches:

  • Site-directed mutagenesis: Generate specific MRH1 variants through PCR-based methods to target conserved residues or domains of interest.

  • Multiplexed assays of variant effects (MAVEs): This high-throughput approach can systematically assess functional consequences of numerous MRH1 variants simultaneously . It involves:

    • Creating site-saturation mutagenesis libraries divided into manageable tiles

    • Cloning libraries into appropriate assay vectors

    • Performing parallel stability and interaction assays

    • Deep sequencing to correlate genotypes with phenotypes

  • In vitro biochemical assays: Purified MRH1 variants can be characterized through:

    • Thermal stability assays (differential scanning fluorimetry)

    • Circular dichroism to assess secondary structure changes

    • Activity assays specific to hypothesized MRH1 functions

As demonstrated with MLH1 variants, this integrated approach can distinguish between variants affecting protein stability, protein-protein interactions, or both properties .

What methods can identify and validate protein interactions involving MRH1?

Multiple complementary approaches should be employed to identify and validate MRH1 interaction partners:

  • Co-immunoprecipitation (Co-IP): Using antibodies against tagged MRH1 or potential interacting proteins to pull down complexes from yeast cell lysates.

  • Pull-down assays: Employing purified His-tagged MRH1 as bait protein immobilized on nickel resin to capture interacting partners from cell extracts .

  • Cross-linking mass spectrometry: For capturing transient interactions through chemical cross-linking followed by identification via mass spectrometry.

  • In vitro recruitment assays: Similar to approaches used for MLH2, researchers can test whether purified MRH1 can be recruited to specific targets by potential interacting proteins .

  • Fluorescence microscopy-based approaches: Co-localization studies using fluorescently-tagged MRH1 can provide spatial information about interaction contexts, similar to fluorescent foci studies conducted for MLH1-MLH2 .

For validation, researchers should employ at least two orthogonal methods to confirm each interaction, as each technique has inherent limitations and potential for false positives.

How can researchers determine if MRH1 participates in specific cellular pathways?

To establish MRH1's role in cellular pathways, researchers should implement a systematic experimental workflow:

  • Genetic interaction screens: Synthetic genetic array (SGA) analysis crossing MRH1 deletion strains with genome-wide deletion collections to identify genetic interactions.

  • Phenotypic profiling: Comparing growth characteristics of MRH1 deletion strains under various stress conditions to identify sensitivity patterns indicative of pathway involvement.

  • Epistasis analysis: Testing double mutants containing MRH1 deletion and mutations in known pathway components to determine hierarchical relationships.

  • Transcriptome analysis: RNA-seq comparing wild-type and MRH1 deletion strains to identify differentially expressed genes that may indicate pathway connections.

  • Proteomics approaches: Stable isotope labeling (SILAC) combined with mass spectrometry to identify proteins whose abundance changes upon MRH1 deletion.

Researchers should integrate these datasets to build a comprehensive understanding of MRH1 pathway involvement, similar to the approach used to characterize the role of MLH1-MLH2 in DNA mismatch repair .

How can researchers design effective site-directed mutagenesis studies for MRH1?

Designing impactful site-directed mutagenesis studies for MRH1 requires strategic planning:

  • Target selection criteria:

    • Conserved residues identified through sequence alignments across species

    • Domains predicted to participate in protein-protein interactions

    • Residues implicated in post-translational modifications

    • Regions with predicted functional motifs

  • Mutation design principles:

    • Conservative substitutions (maintaining physicochemical properties) to test structural roles

    • Non-conservative substitutions to disrupt specific interactions

    • Alanine scanning of putative interaction surfaces

    • Phosphomimetic mutations (S/T to D/E) to test regulation hypotheses

  • Validation approach:

    • Express both wild-type and mutant proteins in parallel

    • Verify expression levels and stability through western blotting

    • Assess subcellular localization using fluorescent tagging

    • Test functional consequences through appropriate assays

This systematic approach parallels successful mutagenesis studies conducted on other yeast proteins such as MLH1, where researchers distinguished mutations affecting protein stability from those affecting protein interactions .

What approaches are recommended for studying MRH1 in the context of cellular processes?

To understand MRH1's role in cellular processes, researchers should implement these methodological approaches:

  • Live-cell imaging techniques:

    • Fluorescent protein tagging of MRH1 to monitor localization dynamics

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein mobility

    • Multi-color imaging to track co-localization with organelle markers

  • Inducible expression/depletion systems:

    • Tetracycline-regulated promoters for controlled expression

    • Auxin-inducible degron tags for rapid protein depletion

    • Temperature-sensitive alleles for conditional inactivation

  • Cell cycle synchronization methods:

    • α-factor arrest and release for G1 synchronization

    • Hydroxyurea treatment for S-phase arrest

    • Nocodazole treatment for G2/M arrest

  • Stress response studies:

    • Oxidative stress induction (H₂O₂, menadione)

    • DNA damage agents (phleomycin, similar to that used in MLH1-MLH2 studies)

    • Metabolic stress conditions (carbon source shifts)

These approaches can be particularly valuable when investigating whether MRH1 has functional similarities to other characterized yeast proteins or participates in similar cellular response pathways.

How should researchers analyze MRH1 in relation to homologous proteins?

A comprehensive comparative analysis of MRH1 should include:

  • Phylogenetic analysis methodologies:

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Construction of phylogenetic trees using maximum likelihood methods

    • Bootstrap analysis to assess node confidence

    • Ancestral sequence reconstruction to infer evolutionary changes

This approach parallels the phylogenetic analysis used to establish that S. cerevisiae Mlh2 and mammalian PMS1 are homologs , and could reveal similar evolutionary relationships for MRH1.

  • Functional domain conservation analysis:

    • Identification of conserved motifs across species

    • Mapping conservation scores onto structural models

    • Comparison of domain architecture between homologs

    • Analysis of selection pressure (dN/dS ratios) across protein regions

  • Cross-species complementation testing:

    • Expression of homologs from different species in S. cerevisiae MRH1 deletion strains

    • Assessment of functional rescue through phenotypic assays

    • Construction and testing of chimeric proteins with domain swaps

    • Analysis of species-specific interaction partners

Similar approaches have been successful in analyzing MLH1 variants, where researchers demonstrated the feasibility of constructing functional hybrid human-yeast MLH1 proteins .

What methodologies are recommended for integrating MRH1 research findings?

To effectively integrate diverse experimental data on MRH1, researchers should:

  • Implement systematic data integration frameworks:

    • Establish standardized formats for experimental results

    • Create centralized databases for MRH1-related findings

    • Develop visualization tools for multi-dimensional data

    • Apply machine learning approaches to identify patterns across datasets

  • Use network biology approaches:

    • Construct protein-protein interaction networks centered on MRH1

    • Integrate genetic interaction data with physical interaction maps

    • Perform pathway enrichment analysis on networked components

    • Identify network motifs that suggest functional modules

  • Adopt structural biology integration methods:

    • Map functional data onto protein structural models

    • Correlate variant effects with structural features

    • Model protein complexes based on interaction data

    • Predict functional sites through evolutionary and structural analysis

These integration approaches parallel those used to evaluate MLH1 variants, where researchers combined multiple functional assays to better predict cancer risk in individuals carrying MLH1 variants .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.