Recombinant Saccharomyces cerevisiae Protein NAG1 (NAG1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Shipping is standard with blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
NAG1; YGR031C-A; Protein NAG1; Nested antisense gene 1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-163
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
NAG1
Target Protein Sequence
MNSAGRVHRSRAGSRGHAAISPLTMASFSVARGIRSSNVYDDTDDELSILTFFSAVRRNR LTSSLPPILSARCSSACFSVRIVLPLSLTISISALMYSTNSALGRKLTGAFSIQTNIEQS CGFFRTSIMATLPPIECPIIIGPPLVFNSCFVIKCFTSSDMTS
Uniprot No.

Target Background

Function
Involved in yeast cell wall biogenesis.
Gene References Into Functions
  1. NAG1 plays a dual role: contributing to yeast cell wall biogenesis and presenting a novel genomic context, suggesting the potential existence of other nested protein-coding genes in eukaryotic genomes. PMID: 18310357
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is NAG1 and why is it significant in eukaryotic genomics?

NAG1 (Nested Antisense Gene 1) represents an unconventional genomic architecture in Saccharomyces cerevisiae. It is a protein-coding gene nested entirely within the coding sequence of the YGR031W open reading frame but in an antisense orientation on the opposite DNA strand . This genomic organization challenges the traditional assumption that protein-coding sequences do not completely overlap in eukaryotes.

NAG1 encodes a 19-kDa protein that localizes to the yeast cell periphery, contains putative transmembrane domains, and cofractionates with known plasma membrane proteins . Its significance extends beyond its cellular function, as it represents a novel genomic architecture that suggests other similar nested protein-coding genes may exist in eukaryotic genomes that have been overlooked by conventional gene annotation algorithms .

How was NAG1 initially discovered and verified as a protein-coding gene?

NAG1 was discovered through a gene trap mutagenesis approach using a mini-transposon containing a 5'-truncated lacZ reporter lacking its promoter and start codon. This design ensures β-galactosidase activity only results when the transposon integrates in-frame with a protein-coding sequence .

Verification of NAG1 as a protein-coding gene involved multiple complementary approaches:

  • β-galactosidase fusion analysis: Researchers detected an approximately ninefold increase in β-galactosidase activity in strains carrying a transposon insertion in NAG1 compared to control strains with insertions in noncoding DNA .

  • Western blotting: A hemagglutinin (HA)-tagged version of Nag1p was created and detected using anti-HA antibodies, confirming the translation of the protein .

  • Sequence analysis: The NAG1 ORF was found to be greater than 100 codons in length and evolutionarily conserved across fungal species, supporting its protein-coding potential .

What methodologies are recommended for studying NAG1 expression and regulation?

For comprehensive analysis of NAG1 expression and regulation, researchers should employ multiple complementary approaches:

  • Reporter gene fusions: NAG1-lacZ or NAG1-GFP fusions can quantitatively monitor expression levels under different conditions .

  • Western blot analysis: For protein-level detection, epitope tagging (particularly HA-tagging) has proven effective in detecting Nag1p. The addition of a 3×HA tag at the C-terminus preserves protein function while enabling detection .

  • qRT-PCR: For transcript-level analysis, primers should be designed specifically to the antisense strand to avoid amplifying the overlapping YGR031W gene .

  • Stress response studies: Treating cells with calcofluor white (a cell wall-perturbing agent) can help study NAG1 induction, as Nag1p levels increase under this condition .

  • Genetic backgrounds: Studies in wild-type, slt2Δ, and rlm1Δ deletion strains can elucidate pathway-dependent regulation, as NAG1 expression is partially dependent on the Slt2p MAPK pathway and its downstream transcription factor Rlm1p .

What is the functional role of NAG1 in S. cerevisiae?

NAG1 plays an important role in cell wall biogenesis and integrity in S. cerevisiae. Evidence for this function comes from multiple experimental approaches:

  • Phenotypic analysis: A site-directed mutant (nag1-1) that disrupts NAG1 while preserving YGR031W function exhibits hypersensitivity to calcofluor white, a cell wall-perturbing agent .

  • Transcriptome analysis: Microarray profiling of the nag1-1 mutant reveals decreased expression of genes contributing to cell wall organization and biosynthesis .

  • Stress response: Nag1p levels increase upon calcofluor white treatment, suggesting its involvement in the cell wall stress response .

  • Signaling pathway dependence: NAG1 expression is regulated by the Slt2p MAPK pathway and its downstream transcription factor Rlm1p, which are key components of the yeast cell wall integrity pathway .

These findings collectively indicate that while Nag1p may not directly contribute to cell wall structure, it likely functions as a regulatory protein affecting cell wall gene expression .

How can researchers distinguish between NAG1 and YGR031W functions experimentally?

Distinguishing between NAG1 and YGR031W functions requires careful experimental design due to their overlapping genomic organization. Recommended approaches include:

  • Site-directed mutagenesis: Create mutations that disrupt one gene while preserving the other. For example, the nag1-1 mutant contains nucleotide changes that introduce a premature stop codon in NAG1 but are silent with respect to YGR031W due to the degeneracy of the genetic code .

  • Subcellular localization: YGR031W encodes a mitochondrial protein, while Nag1p localizes to the cell periphery. Fluorescent protein tagging and microscopy can differentiate their locations .

  • Functional assays: Test for phenotypes specific to each gene's function. NAG1 disruption affects cell wall integrity (calcofluor white sensitivity), while YGR031W likely has mitochondrial-related phenotypes .

  • Expression analysis: Use strand-specific RT-PCR or RNA-Seq to distinguish between transcripts from opposite DNA strands .

  • Protein-specific antibodies: Develop antibodies against unique epitopes of each protein for specific detection in Western blots and immunoprecipitation experiments .

What is known about NAG1 conservation across fungal species?

NAG1 exhibits an interesting pattern of evolutionary conservation:

  • Fungal conservation: NAG1 is conserved among fungi as a unit oriented opposite an ortholog of YGR031W. This conservation pattern suggests functional importance and co-evolution of this gene pair .

  • Genomic architecture: The nested antisense configuration of NAG1 relative to YGR031W is maintained across fungal species, suggesting selective pressure to preserve this unusual genomic arrangement .

  • Sequence conservation: While exact sequence identity percentages are not provided in the available literature, the NAG1 ORF shows sufficient conservation to be identified across fungal genomes through comparative genomics .

  • Functional conservation: The cell wall-related function of NAG1 appears to be conserved, consistent with the importance of cell wall integrity across fungal species .

The conservation of this nested gene architecture raises interesting evolutionary questions about the origins and maintenance of overlapping genes in eukaryotes .

How does the Slt2p MAPK pathway regulate NAG1 expression?

The regulation of NAG1 by the Slt2p MAPK pathway involves several components and mechanisms:

  • Transcriptional control: The Slt2p MAPK pathway regulates NAG1 expression through the downstream transcription factor Rlm1p. This was demonstrated by significant decreases in Nag1p levels in both slt2Δ and rlm1Δ deletion strains during vegetative growth and calcofluor white treatment .

  • Promoter analysis: A consensus binding site for Rlm1p (CTA(T/A)4TA) is present approximately 430 nucleotides upstream of the presumed NAG1 start codon, providing a direct mechanism for transcriptional regulation .

  • Shared regulatory elements: Interestingly, NAG1 may share its promoter region with GSC2, the inducible subunit of 1,3-β-glucan synthase and a gene that is upregulated by cell wall stress. Since the Rlm1p binding site is palindromic, it can control transcription of appropriately oriented ORFs on either DNA strand .

  • Basal vs. stress-induced regulation: NAG1 expression is regulated by both basal signaling through the Slt2p pathway during vegetative growth and increased signaling under cell wall stress conditions .

ConditionWild-typeslt2Δrlm1Δ
Vegetative growthNormal expressionDecreased expressionMarkedly decreased expression
Calcofluor white treatmentIncreased expressionDecreased relative to WT but increased relative to untreated mutantDecreased relative to WT but increased relative to untreated mutant

These findings indicate that while the Slt2p pathway significantly contributes to NAG1 regulation, other pathways may also be involved, particularly under stress conditions .

What experimental challenges arise when expressing and purifying recombinant NAG1 protein?

Working with recombinant NAG1 presents several specific challenges:

  • Membrane protein properties: Nag1p contains putative transmembrane domains and exhibits properties consistent with plasma membrane localization, making it potentially difficult to express and solubilize using standard recombinant protein methods .

  • Expression system selection: While E. coli is commonly used for recombinant protein expression, a yeast expression system may be more appropriate for Nag1p to ensure proper folding and post-translational modifications. Researchers have successfully used GST-tagged constructs in standard expression systems .

  • Purification strategy: For functional studies, researchers have used several approaches:

    • GST-fusion proteins (pGEX-GFP-c-CRD and pGEX-ΔGFP-c-CRD constructs)

    • HA-tagged versions for detection in yeast

    • GFP fusions for localization studies

  • Buffer optimization: Given its membrane association, detergent selection is critical. Buffers containing appropriate non-ionic detergents (e.g., Triton X-100 or n-dodecyl-β-D-maltoside) at concentrations that solubilize but don't denature the protein are recommended .

  • Storage considerations: Purified recombinant NAG1 is typically stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Repeated freezing and thawing should be avoided, and working aliquots can be stored at 4°C for up to one week .

How can researchers create NAG1 mutants without affecting YGR031W expression?

Creating NAG1-specific mutations requires carefully designed strategies due to the overlapping genomic architecture:

  • Degeneracy of the genetic code: Researchers can exploit codon degeneracy to introduce mutations that affect NAG1 while preserving the amino acid sequence of YGR031W. This approach was used to create the nag1-1 mutant, which contains a premature stop codon in NAG1 but uses synonymous codons that don't alter the YGR031W protein .

  • Site-directed mutagenesis workflow:

    • Identify target regions where alternative nucleotides can change the NAG1 coding sequence without affecting YGR031W

    • Design primers containing the desired mutations

    • Perform PCR-based site-directed mutagenesis

    • Confirm mutations by sequencing both strands

    • Validate effects on both proteins using functional assays

  • Codon optimization software: Specialized software that considers overlapping genes can help identify optimal mutation sites .

  • Expression validation: After mutagenesis, it's critical to confirm that YGR031W expression remains unaffected while NAG1 is disrupted. This can be done through:

    • Strand-specific RT-PCR

    • Western blotting for both proteins

    • Functional assays specific to each protein

This approach allows for precise genetic manipulation and phenotypic analysis of NAG1 without the confounding effects of simultaneously disrupting YGR031W.

How does cell wall stress affect NAG1 expression and what methods can measure this response?

Cell wall stress significantly impacts NAG1 expression through specific mechanisms:

  • Induction by calcofluor white: Treatment with calcofluor white, a compound that binds to chitin and disturbs cell wall assembly, induces a modest increase in Nag1p levels. This induction is consistent with the role of NAG1 in the cell wall stress response .

  • Pathway dependence: The cell wall stress response of NAG1 is partially dependent on the Slt2p MAPK pathway and its downstream transcription factor Rlm1p, although other pathways also contribute .

To measure this response accurately, researchers have employed several complementary methods:

  • Western blotting: Using HA-tagged Nag1p or Nag1p-β-galactosidase chimeras, protein levels can be quantified before and after calcofluor white treatment in different genetic backgrounds (wild-type, slt2Δ, rlm1Δ) .

  • Reporter gene assays: β-galactosidase activity from NAG1-lacZ fusions provides a quantitative measure of induction .

  • Time-course analysis: Examining the kinetics of induction reveals that changes in Nag1p levels occur relatively quickly after cell wall stress, similar to other cell wall integrity genes .

  • Transcriptome analysis: RNA-Seq or microarray analysis can place NAG1 induction in the context of the broader cell wall stress response, identifying co-regulated genes and potential functional relationships .

  • Microscopy: Fluorescent protein-tagged Nag1p can be used to visualize changes in protein localization or abundance following stress treatment .

What other potential nested antisense genes might exist in the S. cerevisiae genome?

The discovery of NAG1 suggests that other nested antisense genes may exist in the S. cerevisiae genome that have been overlooked by conventional annotation methods:

  • Transposon mutagenesis screening: The same gene trap approach that identified NAG1 revealed a set of at least 54 putative nested genes in yeast that are positioned opposite and antisense to annotated genes .

  • Criteria for identification: Potential protein-coding nested antisense genes would typically:

    • Be greater than 100 codons in length

    • Be oriented opposite an annotated ORF

    • Show expression during normal growth or specific conditions

    • Potentially have evolutionary conservation across related species

  • Validation requirements: Confirming these candidates as genuine protein-coding genes requires:

    • Detection of the encoded protein (via epitope tagging, mass spectrometry)

    • Functional characterization through specific mutations

    • Evidence of evolutionary conservation

  • Implications for genome annotation: The existence of NAG1 challenges current gene prediction algorithms that typically discard overlapping ORFs in favor of longer ones. This suggests a need for more sophisticated annotation approaches that can identify nested antisense genes .

While not all 54 putative nested ORFs identified in the initial screen are expected to encode functional proteins, NAG1 serves as proof that at least some do, opening an unexplored area of yeast biology with potential implications for gene prediction in all eukaryotes .

What are the differences between NAG1 in S. cerevisiae and NAG gene systems in other fungi?

It's important to distinguish between S. cerevisiae NAG1 (Nested Antisense Gene 1) and similarly named NAG genes in other fungi that serve different functions:

  • S. cerevisiae NAG1:

    • A nested antisense gene located within YGR031W

    • Encodes a 19-kDa plasma membrane protein involved in cell wall integrity

    • Not involved in N-acetylglucosamine (GlcNAc) metabolism

  • Candida albicans NAG genes:

    • Comprise a system of genes (NAG1-NAG5) involved in GlcNAc utilization

    • NAG1 encodes a glucosamine-6-phosphate deaminase

    • NAG2 encodes a GlcNAc-6-phosphate deacetylase

    • NAG3/NAG4 encode GlcNAc permeases

    • NAG5 encodes a GlcNAc kinase

GeneS. cerevisiae NAG1C. albicans NAG1
FunctionCell wall integrity regulationGlucosamine-6-phosphate deaminase
Genomic contextNested antisense to YGR031WNot nested, part of GlcNAc utilization cluster
Size19 kDa proteinDifferent size (not specified in sources)
RegulationRegulated by Slt2p MAPK pathwayInduced by GlcNAc
Cellular locationCell periphery/plasma membraneCytoplasmic

The similarity in naming despite different functions highlights the importance of clear terminology when discussing these systems in scientific literature .

What advanced microscopy techniques are recommended for studying Nag1p localization?

For detailed characterization of Nag1p subcellular localization, several advanced microscopy approaches are recommended:

  • Confocal laser scanning microscopy: This has been successfully employed to visualize GFP-tagged Nag1p, providing high-resolution images of its cell periphery localization .

  • Co-localization studies: Dual-color fluorescence microscopy using Nag1p tagged with one fluorophore (e.g., GFP) and known plasma membrane markers tagged with a different fluorophore (e.g., mCherry) can confirm membrane localization through co-localization analysis .

  • Live-cell imaging: For studying dynamic changes in Nag1p localization during cell wall stress responses, live-cell imaging with temperature and environmental control is recommended .

  • Super-resolution microscopy: Techniques such as structured illumination microscopy (SIM) or stimulated emission depletion (STED) microscopy can provide nanoscale resolution of Nag1p distribution within the plasma membrane, potentially revealing any domain-specific organization .

  • Correlative light and electron microscopy (CLEM): This combined approach allows precise localization of Nag1p at the ultrastructural level, which is particularly valuable for membrane proteins .

  • Sample preparation considerations:

    • Use of minimal fixation to preserve native membrane structure

    • Careful selection of mounting media to minimize background

    • Inclusion of appropriate controls for autofluorescence and non-specific binding

These approaches can definitively distinguish Nag1p's plasma membrane localization from the mitochondrial localization of YGR031W, supporting functional studies of these overlapping genes .

How does NAG1 interact with the broader cell wall biogenesis network?

NAG1 functions within a complex network of genes and signaling pathways involved in cell wall biogenesis:

  • Transcriptional network analysis: Microarray profiling of the nag1-1 mutant reveals decreased expression of multiple genes involved in cell wall organization and biosynthesis, suggesting that NAG1 positively regulates a subset of cell wall genes .

  • Signaling pathway integration: NAG1 expression is regulated by the Slt2p MAPK cell wall integrity pathway and its downstream transcription factor Rlm1p, placing it within a well-characterized signaling cascade .

  • Shared regulation with GSC2: NAG1 may share its promoter region with GSC2, the inducible subunit of 1,3-β-glucan synthase, suggesting coordinated regulation of these cell wall-related genes .

  • Stress response correlation: Similar to many cell wall-related genes, NAG1 is induced by cell wall stress (calcofluor white treatment), indicating its participation in the cell wall stress response .

  • Phenotypic evidence: The nag1-1 mutant's hypersensitivity to calcofluor white provides functional evidence of its role in cell wall integrity, though this phenotype is relatively mild compared to some structural cell wall genes .

The current model suggests that rather than functioning as a structural cell wall component, Nag1p likely serves as a regulatory protein affecting the expression of other cell wall genes through mechanisms that are still being elucidated .

What are the recommended controls for NAG1 expression and functional studies?

For rigorous analysis of NAG1 expression and function, several critical controls should be implemented:

  • Genetic controls:

    • Wild-type strains for baseline expression levels

    • YGR031W-specific mutants (preserving NAG1) for comparison

    • NAG1-specific mutants (preserving YGR031W) like nag1-1

    • slt2Δ and rlm1Δ strains to evaluate pathway dependence

  • Expression analysis controls:

    • Strand-specific RT-PCR to confirm antisense transcription

    • Multiple reference genes for qRT-PCR normalization

    • Empty vector controls for plasmid-based expression

    • Non-tagged protein controls for epitope tag studies

  • Protein detection controls:

    • Untagged strains for antibody specificity

    • Multiple epitope tags (HA, GFP) to ensure tag doesn't affect function

    • Western blot loading controls appropriate for membrane proteins

  • Functional assays:

    • Range of calcofluor white concentrations (typically 5-50 μg/ml) for sensitivity testing

    • Multiple cell wall stressors (e.g., Congo red, SDS) to distinguish general vs. specific cell wall defects

    • Growth curve analysis rather than just endpoint measurements

    • Cell wall composition analysis (e.g., β-glucan and chitin content)

  • Localization studies:

    • Co-staining with established membrane markers

    • Controls for fixation artifacts

    • Z-stack imaging to confirm membrane vs. internal localization

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.