Recombinant Saccharomyces cerevisiae Protein PER1 (PER1)

Shipped with Ice Packs
In Stock

Description

Genetic Information and Nomenclature

The PER1 protein in Saccharomyces cerevisiae is encoded by the PER1 gene, also known by its synonym COS16 . The gene is precisely located in the yeast genome with the ordered locus name YCR044C and the ORF name YCR44C . This nomenclature follows the standard S. cerevisiae genome project conventions, with "YC" indicating its location on chromosome III, "R" denoting the right arm of the chromosome, and "044C" signifying its specific position and orientation on the complementary strand.

Role in O-linked Glycosylation and GPI Anchor Processing

PER1 has been functionally categorized under processes related to "O-linked glycosylation/GPI" pathways . This classification indicates that PER1 plays a significant role in post-translational modifications of proteins, specifically in the addition of glycosyl groups to serine or threonine residues (O-linked glycosylation) or in the processing of glycosylphosphatidylinositol (GPI) anchors that attach certain proteins to the cell membrane.

The importance of proper glycosylation extends beyond structural roles, as research has demonstrated that O-linked glycosylation can significantly modulate peptide hormone half-lives and receptor activation properties . While not directly studied in the context of yeast PER1, these findings highlight the broader significance of glycosylation processes that PER1 may influence.

Involvement in ER Homeostasis and Protein Processing

The full name "Protein processing in the ER protein 1" clearly indicates PER1's involvement in endoplasmic reticulum processes . In a comprehensive genome-wide analysis examining components acting in ER homeostasis, PER1 (YCR044C) was identified with a "Kar2p secretion index" of 6.1 . This metric relates to the secretion of Kar2p (a yeast ER chaperone orthologous to mammalian BiP) and suggests that PER1 contributes significantly to either the retention of ER resident proteins or the quality control processes that maintain the fidelity of protein secretion.

The following table summarizes key functional characteristics of PER1 based on available research:

CharacteristicDescriptionReference
Functional CategoryO-linked glycosylation/GPI
Kar2p Secretion Index6.1
Synthetic Lethal with hac1ΔNo
Kar2p Secretion in hac1ΔNegative
Recommended NameProtein PER1
Alternative NameProtein processing in the ER protein 1

Research Applications and Experimental Utility

As a protein involved in fundamental cellular processes, recombinant PER1 serves as a valuable tool for researchers investigating various aspects of:

  1. ER protein processing pathways

  2. Mechanisms of O-linked glycosylation in yeast

  3. GPI anchor attachment and processing

  4. Quality control systems in the secretory pathway

  5. Comparative studies of protein processing across different yeast strains or species

The availability of purified recombinant PER1 enables in vitro studies that can elucidate the specific biochemical activities and interactions of this protein, complementing in vivo genetic studies that have identified its functional categories.

PER1 in the ER Secretory Pathway Network

Research has identified PER1 as part of a broader network of genes affecting endoplasmic reticulum homeostasis. In a genome-wide screen for mutants that secrete ER resident proteins to the cell surface, PER1 was identified among 87 yeast mutants that secrete at least twofold more Kar2p than wild-type cells . This places PER1 within important cellular pathways involved in protein folding, glycosylation, GPI anchor maturation, ER quality control, and ER retrieval mechanisms.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PER1; COS16; YCR044C; YCR44C; Protein PER1; Protein processing in the ER protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-357
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PER1
Target Protein Sequence
DNLDEFIDCTYACEYNRRCPNSQINYIDPETNMFHDIEFFDTPPLYSKLLFWDCISDCDY QCQHIITRWRIDEEEEIYQFHGKWPFLRVLGTQEFFSTIFSIGNFIPHYKGFVKFSRIIR EEGDRRRKNSRSILIWNYLYVTVAGMLAWTASSVFHCRDLIITEKLDYFFAGLTVLTGFH AIFARMTSMFLYPKIAQAFTASVAAIFALHILRLYVDWSYTYNMRFNIFFGVLQYILLIM LSCQNYHALQKQKLMGEFKKTAYSSFKRQIFKLCVIPILLVIVTTMAMSLELFDFFSYEW QIDAHALWHLCTIWPSWVLYDFFLEDYAYWGNRQLY
Uniprot No.

Target Background

Function
PER1 plays a crucial role in the lipid remodeling steps involved in GPI-anchor maturation. This remodeling process involves the generation of two saturated fatty chains at the sn-2 position of GPI-anchored proteins. PER1 is essential for phospholipase A2 activity, which removes an acyl-chain at the sn-2 position of GPI-anchors during their remodeling. This activity is crucial for efficient transport of GPI-anchored proteins.
Gene References Into Functions
  1. PER1 encodes an evolutionarily conserved component of the Glycosylphoshatidylinositol (GPI) anchor remodeling pathway, highlighting the close connection between lipid remodeling of GPI and raft association of GPI-anchored proteins. PMID: 17021251
Database Links

KEGG: sce:YCR044C

STRING: 4932.YCR044C

Protein Families
PGAP3/PER1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is PER1 protein and what are its functions in Saccharomyces cerevisiae?

PER1 is a protein involved in the endoplasmic reticulum (ER) processing pathway in Saccharomyces cerevisiae. It plays a crucial role in the protein secretory pathway, particularly in the proper folding and processing of proteins passing through the ER. The protein participates in maintaining ER homeostasis and can influence the secretion efficiency of recombinant proteins. Studies have shown that PER1 activity can affect the unfolded protein response (UPR) pathway, which is critical for managing ER stress during recombinant protein production .

What expression systems are most commonly used for recombinant PER1 production in S. cerevisiae?

Several expression systems are commonly employed for recombinant PER1 production in S. cerevisiae:

  • GAL-based expression systems: The GAL1/10 promoter system offers strong inducible expression with galactose and repression with glucose. This system has been widely used for controlled expression of recombinant proteins in yeast, including those involved in the secretory pathway .

  • Constitutive promoters: Strong constitutive promoters like TDH3 (GPD) can be used when continuous expression is desired.

  • Integration vectors: Random integration using elements like YDRCTy1-1 fragments allows for stable integration of expression cassettes into the yeast genome .

The choice of expression system depends on research objectives - whether tight control of expression timing is needed or if continuous expression is preferred. For proteins that may cause growth defects when overexpressed, inducible systems are typically preferred .

How does the copy number of PER1 influence yeast cellular physiology?

The copy number of PER1, like many yeast genes, has a significant impact on cellular physiology. Research using genetic tug-of-war (gTOW) methodologies has demonstrated that:

  • There exists a copy number limit (CNL) for genes, beyond which cellular growth is impaired

  • Proteins involved in the secretory pathway often have lower CNLs due to dosage sensitivity

  • Overexpression beyond permissible limits disrupts cellular homeostasis

When PER1 is overexpressed beyond its permissible limit, it can cause ER stress and trigger the unfolded protein response (UPR), potentially resulting in growth defects. The balance of proteins in the secretory pathway is critical for optimal cellular function and recombinant protein production .

What are the optimal conditions for PER1 expression in S. cerevisiae?

Optimal conditions for PER1 expression depend on the specific strain and expression system used, but generally include:

Expression parameters:

  • Temperature: 28-30°C for standard growth; lower temperatures (20-24°C) may increase proper folding

  • pH: 4.5-6.0

  • Media composition: Complex media (YPD) for biomass generation; defined media for controlled expression

  • Carbon source: 2% glucose for growth; 2% galactose for induction (GAL system)

  • Aeration: High aeration rates improve protein folding and reduce ER stress

Strain selection considerations:

  • Protease-deficient strains (e.g., pep4Δ) can reduce degradation

  • Strains with enhanced UPR capacity through HAC1 overexpression can improve folding

  • Strains with optimized secretory pathway components

Balancing growth rate and protein expression is critical, as studies have shown that slower growth conditions can sometimes improve secretion of proteins by reducing ER stress .

What purification strategies are most effective for recombinant PER1?

Effective purification of recombinant PER1 typically involves a multi-step approach:

  • Affinity tags selection: His6, FLAG, or Strep tags can be added to either N- or C-terminus depending on protein folding requirements

  • Cell lysis methods: Mechanical disruption (glass beads or high-pressure homogenization) in the presence of protease inhibitors

  • Initial capture: Affinity chromatography using the appropriate resin

  • Intermediate purification: Ion exchange chromatography based on PER1's theoretical pI

  • Polishing step: Size exclusion chromatography to achieve high purity

For intracellular PER1, additional considerations include proper buffer selection to maintain stability and prevent aggregation. Typical buffers include:

  • Extraction: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 1 mM EDTA, 5% glycerol

  • Purification: 50 mM phosphate buffer pH 7.0, 300 mM NaCl

  • Storage: PBS with 10-15% glycerol

A comprehensive purification approach can yield >95% pure protein suitable for structural and functional studies.

How can the secretion of recombinant PER1 be improved in S. cerevisiae?

Improving PER1 secretion involves several engineering strategies:

Genetic approaches:

  • Codon optimization: Adapting the coding sequence to S. cerevisiae preferred codons

  • Signal peptide optimization: Testing various signal sequences (α-factor, PHO5, SUC2) for improved targeting

  • Chaperone co-expression: Overexpressing folding helpers like PDI1, KAR2, or ERO1

  • UPR enhancement: Constitutive expression of HAC1 without its regulatory intron

Process optimization:

  • Fed-batch cultivation: Maintaining low growth rates (0.1-0.15 h⁻¹) to reduce metabolic burden

  • Temperature shifting: Lowering temperature after induction to improve folding

  • Osmotic stress: Addition of sorbitol or NaCl to strengthen cell wall and reduce protein loss

Advanced genetic engineering approaches:

  • Deletion of specific proteases: Removing genes encoding vacuolar proteases (PEP4, PRB1)

  • Engineered strains: Using evolved strains with enhanced secretory capacity

  • CRISPR/Cas9 modifications: Targeted integration of beneficial mutations identified in evolved strains

How does PER1 interact with the unfolded protein response (UPR) during recombinant protein production?

PER1 interacts with the UPR through multiple mechanisms:

  • UPR activation: PER1 overexpression or misfolding can trigger UPR activation through IRE1/HAC1 signaling pathway

  • Transcriptional feedback: UPR activation modulates PER1 expression levels

  • Chaperone interactions: PER1 processing requires interaction with ER chaperones that are upregulated during UPR

Research has demonstrated that constitutive activation of UPR through HAC1 expression (with intron removed) can improve recombinant protein production . The relationship between UPR activation and protein production follows a bell-curve pattern - moderate UPR activation is beneficial, while excessive activation is detrimental to cell viability and protein production.

HAC1 overexpression effects on PER1 production:

Balancing UPR activation is therefore critical for optimal PER1 production.

What systems biology approaches can be used to optimize PER1 expression?

Systems biology approaches to optimize PER1 expression include:

  • Transcriptomics: RNA-seq or microarray analysis to identify gene expression changes during PER1 production

  • Proteomics: MS-based quantification of proteome changes and protein-protein interactions

  • Metabolomics: Analysis of metabolic shifts and bottlenecks during recombinant protein production

  • Fluxomics: Metabolic flux analysis to identify rate-limiting steps in protein production

  • Integrated analysis: Reporter feature techniques to identify key regulatory nodes

The systems biology data can guide rational engineering strategies through:

  • Identification of rate-limiting steps in the secretory pathway

  • Discovery of unexpected interactions between PER1 and endogenous proteins

  • Characterization of metabolic burdens imposed by recombinant protein production

  • Prediction of optimal gene targets for overexpression or deletion

An integrated approach combining transcriptomics, proteomics, and targeted genetic modifications has been shown to improve recombinant protein yields by 3-5 fold compared to non-optimized systems .

How do growth rate and metabolic state affect PER1 expression and processing?

Growth rate and metabolic state significantly impact PER1 expression and processing in S. cerevisiae:

Growth rate effects:

Metabolic state influences:

  • Respiratory vs. fermentative metabolism: Respiratory growth (on non-fermentable carbon sources) often provides more efficient energy utilization for protein folding

  • Redox balance: Critical for disulfide bond formation in the ER

  • ATP availability: Impacts chaperone function and quality control mechanisms

Research has demonstrated that different recombinant proteins have distinct optimal production conditions. For example, insulin production primarily depends on gene expression level, whereas amylase secretion is improved at lower growth conditions that reduce ER stress . This suggests that PER1 production optimization would require empirical determination of its specific production characteristics.

What analytical methods are most suitable for characterizing recombinant PER1 structure and function?

Comprehensive characterization of recombinant PER1 requires multiple analytical approaches:

Structural characterization:

  • Circular Dichroism (CD): For secondary structure analysis

  • Fluorescence Spectroscopy: To assess tertiary structure and folding state

  • Mass Spectrometry: For primary structure confirmation and post-translational modification analysis

  • Size-Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): For oligomerization state determination

  • X-ray Crystallography or Cryo-EM: For high-resolution structural studies

Functional characterization:

  • Activity assays: Enzyme-linked assays specific to PER1's functional properties

  • Binding assays: Surface Plasmon Resonance (SPR) or Isothermal Titration Calorimetry (ITC)

  • Thermal stability: Differential Scanning Fluorimetry (DSF) or Differential Scanning Calorimetry (DSC)

  • Yeast complementation assays: Testing functional complementation in per1Δ strains

Quality assessment metrics:

  • Purity: >95% by SDS-PAGE and SEC

  • Identity: Confirmation by peptide mapping and MS

  • Homogeneity: Monodisperse by DLS

  • Activity: Preservation of enzymatic function compared to native protein

What are the common challenges in interpreting PER1 experimental data and how can they be addressed?

Researchers face several challenges when interpreting PER1 experimental data:

Data interpretation challenges:

  • Distinguishing native from recombinant protein: Especially when analyzing function in a yeast background

  • Post-translational modification heterogeneity: Variations in glycosylation or other modifications

  • Effects of tags or fusion partners: Potential artifacts introduced by purification tags

  • Growth effects vs. direct protein effects: Differentiating between primary and secondary effects

  • Batch-to-batch variability: Ensuring reproducibility across experiments

Proposed solutions:

  • Control experiments: Include non-expressing strains and tag-only controls

  • Orthogonal validation: Confirm findings using multiple methodologies

  • Statistical robustness: Perform sufficient biological and technical replicates (minimum n=3)

  • Standardized protocols: Develop and adhere to standardized growth, expression, and analysis protocols

  • Careful experimental design: Include time-course experiments to capture dynamic effects

Data reporting recommendations:

  • Provide complete strain construction details

  • Document all growth conditions precisely

  • Report both absolute and specific productivity values

  • Include raw data when possible

  • Discuss limitations and alternative interpretations

What emerging technologies show promise for improving PER1 production and study?

Several emerging technologies hold promise for advancing PER1 research:

Genetic engineering innovations:

  • CRISPR/Cas9 applications: Precise genome editing for pathway optimization

  • Synthetic genomics: De novo design of optimized secretory pathways

  • Gene circuits: Dynamic control of expression in response to cellular states

Analytical advancements:

  • Single-cell proteomics: Understanding cell-to-cell variation in protein production

  • In vivo structural biology: Studying protein folding in native environments

  • AI-driven protein engineering: Computational design of improved variants

Process technologies:

  • Continuous cultivation systems: Maintaining optimal production states

  • Real-time monitoring: PAT (Process Analytical Technology) integration

  • Automated screening platforms: High-throughput optimization of conditions

Integration of these technologies could lead to significant improvements in both the fundamental understanding of PER1 biology and its production efficiency for research applications.

How can PER1 research inform broader questions in recombinant protein production?

PER1 research can provide valuable insights into several broader areas:

  • Secretory pathway engineering: Understanding rate-limiting steps and regulatory mechanisms

  • Protein quality control systems: Elucidating folding, degradation, and trafficking decisions

  • Host-protein interactions: Identifying cellular responses to heterologous protein expression

  • Evolutionary conservation: Comparing secretory processes across species

Lessons learned from PER1 studies can be applied to improve production of other challenging proteins, especially those that interact with the secretory pathway. The systems biology approaches used in PER1 optimization can serve as a template for rational engineering of yeast for production of various biopharmaceuticals and industrial enzymes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.