Recombinant Saccharomyces cerevisiae Protein RER1 (RER1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RER1; YCL001W; YCL1W; Protein RER1; Retention of ER proteins 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RER1
Target Protein Sequence
MDYDSSDTMNGGSSNPLITKMNTMKLLYQHYLDKVTPHAKERWAVLGGLLCLFMVRITMA EGWYVICYGLGLFLLNQFLAFLTPKFDMSLQQDEENNELEAGEKSEEFRPFIRRLPEFKF WYNSIRATVISLLLSLFSIFDIPVFWPILLMYFILLFFLTMRRQIQHMIKYRYIPLDIGK KKYSHSSN
Uniprot No.

Target Background

Function
RER1 is involved in retrieving endoplasmic reticulum (ER) membrane proteins from the early Golgi compartment. Its presence is crucial for the correct localization of SEC12, SEC71, and SEC63 within the ER.
Database Links

KEGG: sce:YCL001W

STRING: 4932.YCL001W

Protein Families
RER1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is RER1 and what is its primary function in yeast cells?

RER1 is a Golgi membrane protein in Saccharomyces cerevisiae that serves as a key component of the retrieval machinery that returns proteins from the Golgi apparatus back to the endoplasmic reticulum (ER). It was initially identified as being required for the correct localization of Sec12p, an ER membrane protein that functions as a guanine nucleotide exchange factor for Sar1p in COP II vesicle formation . The primary function of RER1 is to act as a common limiting component in the retrieval machinery for various ER membrane proteins, recognizing and binding to them in the Golgi and facilitating their transport back to the ER through a retrieval mechanism . This retrieval process is essential for maintaining the proper distribution of ER resident proteins and ensuring the correct functioning of the secretory pathway.

How conserved is RER1 across different species?

RER1 demonstrates remarkable evolutionary conservation from yeast to mammals, indicating its fundamental importance in eukaryotic cell biology. The human homologue of yeast Rer1p has been identified and characterized, consisting of 196 amino acids with a molecular mass of approximately 23 kDa . The human RER1 protein shares 44% identity and 65% similarity with its yeast counterpart . Most notably, both proteins contain four putative transmembrane domains predicted to form a W-topology with both N- and C-terminus facing the cytosol .

The functional conservation is equally impressive, as demonstrated by complementation studies where myc-tagged human RER1 was able to rescue the defects in a yeast RER1 deletion strain, reducing the mislocalization of Sec12-reporter protein similar to what is observed with yeast Rer1p . Additionally, RER1 has been identified as an essential gene in Drosophila, where it plays crucial roles in proteostasis and cell survival during development . This high degree of conservation highlights the fundamental importance of RER1's function in eukaryotic cell biology.

What types of ER membrane proteins depend on RER1 for their localization?

RER1 functions as a key component in the retrieval machinery for multiple structurally diverse ER membrane proteins. Initially, RER1 was found to be required for the correct localization of Sec12p, but further studies revealed its role extends to other ER membrane proteins including:

  • Sec71p and Sec63p, which have completely different topology from Sec12p but still depend on RER1 for proper ER localization

  • Components of multisubunit protein complexes such as:

    • The tetrameric γ-secretase complex

    • Yeast iron transporter

    • Skeletal muscle nicotinic acetylcholine receptor (nAChR)

Experiments with Mfalpha1p fusion proteins of Sec12p, Sec71p, and Sec63p demonstrated that all were mislocalized to the trans-Golgi in rer1 mutant yeast strains . Competitive binding experiments showed that either Sec71p or an artificial chimeric protein whose ER localization depends on RER1 could compete for binding to RER1, affecting the localization of Mfalpha1-Sec71p fusion proteins . This competition effect was abolished in rer1 mutants, further confirming RER1's direct role in protein retrieval .

What mechanisms underlie RER1-dependent protein retrieval?

RER1-dependent protein retrieval involves a complex interplay between multiple components of the cellular trafficking machinery. RER1 functions as a receptor in the Golgi that recognizes specific features of ER-resident membrane proteins that have escaped to the Golgi, initiating their retrieval back to the ER. This process involves the following mechanisms:

  • Recognition of target proteins: RER1 appears to recognize specific structural features or motifs within transmembrane domains of ER resident proteins, rather than specific sequences .

  • Cooperation with coat proteins: RER1-mediated retrieval works in conjunction with coat proteins, particularly the COPI complex (coatomer). Studies with α-COP mutants (ret1-1) showed mislocalization of Mfalpha1p fusions of Sec12p, Sec71p, and Sec63p, indicating that both RER1 and coatomer participate in the retrieval process .

  • Limiting component regulation: RER1 functions as a limiting component in the retrieval pathway, as evidenced by the observation that overexpression of ER membrane proteins leads to their mislocalization even in wild-type cells, and this can be partially suppressed by co-overexpression of RER1 .

The retrieval function of RER1 is particularly significant because it demonstrates that many ER membrane proteins rely on continuous recycling between the ER and Golgi rather than absolute retention in the ER, revealing a dynamic aspect of protein localization within the early secretory pathway .

How does loss of RER1 affect cellular proteostasis?

Loss of RER1 has profound effects on cellular proteostasis, triggering multiple stress responses and compromising cell viability. Studies in Drosophila have provided valuable insights into these effects:

  • Induction of unfolded protein response (UPR): RER1-deficient cells show activation of stress-induced unfolded protein responses, indicating accumulation of misfolded proteins and ER stress .

  • Increased protein aggregation: Loss of RER1 leads to increased protein aggregation, as demonstrated by ProteoStat aggresome detection assays. This effect is particularly pronounced when combined with conditions that increase proteostasis demand, such as Myc overexpression .

  • Cell competition effects: In developing Drosophila wing epithelium, RER1 mutant cells surrounded by wild-type cells are eliminated through cell competition, a quality control mechanism that removes suboptimal cells from tissues . The elimination of these cells is characterized by increased apoptosis markers (cleaved Death caspase-1 and Acridine Orange) at the boundary between RER1-deficient and normal cells .

  • Adaptive responses: Interestingly, RER1 levels themselves are upregulated in response to increased proteostasis demand, such as during Myc-overexpression, suggesting that RER1 is part of an adaptive response to proteotoxic stress .

What experimental approaches are most effective for studying RER1 function?

Several complementary experimental approaches have proven effective for studying RER1 function:

  • Genetic manipulation in model organisms:

    • Creation of loss-of-function mutants in yeast and Drosophila

    • RNAi-mediated knockdown in specific tissues or compartments

    • Rescue experiments with wild-type or tagged RER1 constructs

  • Localization studies:

    • Fluorescent protein tagging (e.g., GFP-RER1) to track localization

    • Immunofluorescence with compartment-specific markers

    • Immunoelectron microscopy of thawed cryosections for high-resolution localization

  • Functional complementation assays:

    • Cross-species complementation (e.g., human RER1 in yeast)

    • Assessing localization of reporter proteins (e.g., Sec12-reporter)

  • Protein-protein interaction studies:

    • Co-immunoprecipitation to identify interacting partners

    • Competition assays to assess binding preferences

  • Stress response measurements:

    • Detection of apoptosis markers (e.g., cleaved Death caspase-1, Acridine Orange)

    • ProteoStat aggresome detection assay for protein aggregation

    • UPR pathway activation markers

These approaches can be combined in a research methodology framework that follows the principles of scientific investigation: formulating clear research questions, designing appropriate experiments, collecting and analyzing data systematically, and interpreting results in the context of existing knowledge .

How can recombinant RER1 be expressed and purified for in vitro studies?

Expression and purification of recombinant RER1 presents specific challenges due to its multiple transmembrane domains. Based on successful approaches with similar membrane proteins, the following methodology is recommended:

Expression systems:

  • Bacterial expression: E. coli strains such as BL21(DE3) or C41(DE3) (specialized for membrane proteins) can be used with careful optimization of induction conditions.

  • Yeast expression: S. cerevisiae or Pichia pastoris expression systems may provide more native-like post-translational modifications.

  • Insect cell expression: Baculovirus-infected insect cells (Sf9 or Hi5) can yield higher amounts of properly folded protein.

Purification strategy:

  • Solubilize membrane fractions using mild detergents such as n-dodecyl-β-D-maltoside (DDM), CHAPS, or digitonin.

  • Utilize affinity tags (His6, GST, or MBP) for initial purification step.

  • Follow with size exclusion chromatography to achieve higher purity and assess protein homogeneity.

  • Consider using nanodiscs or amphipols for stabilizing the purified protein in a membrane-like environment.

Quality control:

  • Assess protein folding using circular dichroism spectroscopy.

  • Verify oligomeric state using analytical ultracentrifugation or native PAGE.

  • Confirm functionality through binding assays with known interacting partners.

This methodological approach allows for the production of recombinant RER1 suitable for biochemical and structural studies while maintaining its native-like properties.

What techniques are available for studying RER1 interactions with cargo proteins?

Several complementary techniques can be employed to study RER1 interactions with its cargo proteins:

In vitro binding assays:

  • Pull-down assays: Using purified components to assess direct interactions.

  • Surface plasmon resonance (SPR): For quantitative measurement of binding kinetics and affinities.

  • Microscale thermophoresis (MST): To detect interactions with minimal protein consumption.

  • Isothermal titration calorimetry (ITC): For comprehensive thermodynamic characterization.

Cellular interaction studies:

  • Co-immunoprecipitation: To identify interactions in cellular context.

  • Proximity labeling (BioID, APEX): To identify proteins in close proximity to RER1 in living cells.

  • Förster resonance energy transfer (FRET): To visualize protein-protein interactions in real time.

  • Competition assays: As demonstrated with Sec71p and artificial chimeric proteins competing for RER1 binding .

Functional interaction analysis:

  • Rescue experiments: Testing whether wild-type RER1 can restore proper localization of cargo proteins in RER1-deficient cells.

  • Mutational analysis: Identifying key residues in both RER1 and cargo proteins required for their interaction.

  • Cross-linking mass spectrometry: To map interaction interfaces at the molecular level.

By combining these approaches, researchers can build a comprehensive understanding of how RER1 recognizes and interacts with its diverse set of cargo proteins.

How can researchers analyze the effects of RER1 dysfunction on the secretory pathway?

Analyzing the impact of RER1 dysfunction on the secretory pathway requires a multi-faceted approach:

Morphological analysis:

  • Electron microscopy: To examine ultrastructural changes in the ER and Golgi.

  • Immunofluorescence microscopy: To visualize changes in organelle morphology and distribution of marker proteins.

  • Live cell imaging: To track dynamic changes in organelle morphology and protein trafficking.

Protein localization and trafficking:

  • Reporter protein assays: Using model proteins like Mfalpha1p fusions to monitor mislocalization .

  • Pulse-chase experiments: To track the fate of newly synthesized proteins.

  • RUSH system (Retention Using Selective Hooks): For synchronized visualization of protein trafficking.

Organelle function assessment:

  • Secretion assays: Measuring secretion efficiency of model cargo proteins.

  • Glycosylation analysis: Examining changes in protein glycosylation patterns as indicators of altered trafficking.

  • ERES (ER exit sites) and ERGIC (ER-Golgi intermediate compartment) analysis: To assess early secretory pathway organization.

Stress response evaluation:

  • UPR activation markers: Measuring BiP/Grp78 levels, XBP1 splicing, or PERK phosphorylation.

  • Protein aggregation assays: Using ProteoStat or similar methods to detect misfolded protein aggregates .

  • Apoptosis detection: Using markers such as cleaved caspases or Acridine Orange staining .

This comprehensive approach allows researchers to fully characterize how RER1 dysfunction affects the secretory pathway at multiple levels, from protein trafficking to organelle function and cellular stress responses.

What are the potential therapeutic implications of targeting RER1 function?

Research on RER1 has revealed its critical role in proteostasis, suggesting several potential therapeutic applications:

Neurodegenerative diseases:

  • RER1's role in regulating protein localization and preventing aggregation could be relevant to diseases characterized by protein misfolding, such as Alzheimer's, Parkinson's, and Huntington's diseases.

  • Since RER1 is involved in the assembly of multisubunit protein complexes like γ-secretase , modulating RER1 function might affect amyloid precursor protein processing in Alzheimer's disease.

Cancer therapeutics:

  • The finding that RER1 levels are upregulated during Myc-induced overgrowth and that loss of RER1 is sufficient to suppress this overgrowth suggests that targeting RER1 could potentially inhibit cancer cell proliferation, particularly in Myc-driven cancers.

  • The cell competition mechanism observed in Drosophila, where RER1-deficient cells are eliminated when surrounded by wild-type cells , could potentially be exploited for selective targeting of cancer cells.

Methodological approaches for therapeutic development:

  • High-throughput screening for small molecule modulators of RER1 function.

  • Structure-based drug design targeting the cargo-binding interface of RER1.

  • Gene therapy approaches to modulate RER1 expression in specific tissues.

How might comparative studies of RER1 across species advance our understanding of protein quality control?

Comparative studies of RER1 across different species can provide valuable insights into the evolution and fundamental principles of protein quality control:

Evolutionary conservation analysis:

  • Detailed comparison of RER1 structure and function across yeast, Drosophila, and mammals can identify core conserved mechanisms versus species-specific adaptations.

  • The fact that human RER1 can complement yeast RER1 deletion suggests deep functional conservation that can be further explored.

Species-specific cargo recognition:

  • Comparing the repertoire of RER1-dependent proteins across species can reveal how quality control systems have evolved to accommodate increasing proteome complexity.

  • Analysis of recognition motifs in different organisms may uncover universal principles of membrane protein quality control.

Integration with different stress response pathways:

  • Studies in Drosophila have shown that RER1 loss activates stress-induced unfolded protein responses , but the mechanisms may differ across species.

  • Comparative analysis could reveal how RER1-mediated quality control integrates with other cellular stress responses in different organisms.

Methodological approach for comparative studies:

  • Creation of chimeric RER1 proteins combining domains from different species to map functional conservation.

  • Heterologous expression systems to test cross-species compatibility of RER1-cargo interactions.

  • Bioinformatic analysis of co-evolution between RER1 and its interacting partners.

Such comparative studies would not only advance our basic understanding of protein quality control but could also identify conserved nodes that might be more suitable as therapeutic targets.

Comparative Features of RER1 Across Species

SpeciesProtein SizeSequence Identity to YeastSubcellular LocalizationKey FunctionsReference
S. cerevisiae~20 kDa100%Golgi membraneRetrieval of ER membrane proteins (Sec12p, Sec71p, Sec63p)
Human23 kDa (196 aa)44% identity, 65% similarityGolgi apparatus and ER-Golgi interfaceComplementation of yeast RER1 deletion
DrosophilaNot specifiedNot specifiedNot specifiedEssential for proteostasis, suppression of Myc-induced overgrowth

Effects of RER1 Loss in Different Experimental Systems

Experimental SystemRER1 ManipulationObserved PhenotypesMolecular ConsequencesReference
Yeast (S. cerevisiae)Deletion mutantMislocalization of ER proteinsTransport of ER proteins to trans-Golgi
Drosophila wing epitheliumRNAi knockdownIncreased cell deathUpregulation of cleaved Death caspase-1 and Acridine Orange staining
Drosophila wing epitheliumLoss-of-function mutantClonal elimination via cell competitionProteotoxic stress, elimination at boundary with wild-type cells
Drosophila with Myc overexpressionRNAi knockdownSuppression of Myc-induced overgrowthIncreased protein aggregation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.