Recombinant Saccharomyces cerevisiae Protein ROT1 (ROT1)

Shipped with Ice Packs
In Stock

Description

Recombinant Saccharomyces cerevisiae Protein ROT1 (ROT1): Overview

Recombinant Saccharomyces cerevisiae Protein ROT1 is a molecular chaperone derived from the yeast protein ROT1, an essential type-I endoplasmic reticulum (ER) membrane protein. It functions in vitro to prevent aggregation of denatured proteins and supports folding of diverse substrates in vivo. The recombinant form retains the N-terminal signal sequence and includes a C-terminal HA-His tag for purification, with the transmembrane region replaced to facilitate soluble expression .

Protein Structure

  • Domain Architecture:

    • N-terminal signal sequence: Directs ER translocation.

    • Soluble region: Enables interaction with unfolded proteins.

    • HA-His tag: Facilitates nickel-affinity purification .

  • Post-translational Modifications: N-glycosylated in the ER, confirmed via EndoH treatment .

Antiaggregation Activity

Recombinant ROT1 binds denatured proteins to inhibit aggregation. Key findings include:

SubstrateROT1 Activityrot1-2 Mutation Effect
α-MannosidasePrevents aggregationReduced efficiency
Citrate SynthaseInhibits aggregationPartial impairment

The rot1-2 mutant variant shows diminished chaperone activity in vitro, correlating with its temperature-sensitive phenotype in vivo .

In Vivo Role and Substrate Specificity

ROT1 stabilizes diverse ER-resident proteins by preventing misfolding and ER-associated degradation (ERAD). Key substrates include:

ProteinTypeInteraction with ROT1Dependency on BiP
Kre6Soluble (type II)Transient binding Yes
Drs2Polytopic membranePhysical interaction Yes
CPY (CPY*)Soluble (type I)Indirect evidence Yes
Pdi1Soluble (type II)Physical interaction Yes
Erg25Polytopic membranePhysical interaction Yes

Key Observations:

  • Substrate Diversity: ROT1 supports folding of soluble, type I/II, and polytopic membrane proteins without structural homology .

  • Cooperation with BiP: One substrate (e.g., Kre6) interacts simultaneously with ROT1 and BiP, suggesting collaborative chaperone activity .

  • ERAD Pathway: rot1-2 mutations accelerate degradation of ROT1-dependent proteins via Ubc7-mediated ERAD, indicating misfolding under stress .

Expression and Purification

  • Host: Yeast cells (e.g., Saccharomyces cerevisiae) under the TDH3 promoter .

  • Purification: Nickel-affinity chromatography followed by gel filtration .

  • Storage: Tris-based buffer with 50% glycerol at -20°C .

Applications in Research

  • In Vitro Aggregation Assays: Validates chaperone function and substrate specificity .

  • Protein Interaction Studies: Co-immunoprecipitation (Co-IP) to identify ROT1-binding partners .

  • Functional Rescue Experiments: Complements rot1-2 phenotypes in folding-defective mutants .

Genetic and Functional Insights

PropertyDescription
Genetic LocusYMR200W (ORF: YM8325.01)
Functional MotifsNone identified; chaperone activity is intrinsic to its soluble domain
Genetic InteractionsROT1 interacts with BiP/Kar2 (ER chaperones) and sec59-1 (dolichol kinase) .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ROT1; SCY_4378; Protein ROT1; Reversal of TOR2 lethality protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-256
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
ROT1
Target Protein Sequence
EDESNSIYGTWSSKSNQVFTGPGFYDPVDELLIEPSLPGLSYSFTEDGWYEEATYQVSGN PRNPTCPMASLIYQHGTYNISENGTLVLNPIEVDGRQLFSDPCNDDGVSTYSRYNQTETF KEYAVGIDPYHGIYTLQLYQYDGTPMQPLYLAYRPPMMLPTETLNPTSSATSTDDSSSNK KRSLRSLVRRSLENRHKTNAIKRQNTSFLTSNAIWYISAGMLGVGSLLFLAF
Uniprot No.

Target Background

Function

Function: Essential for maintaining normal levels of cell wall 1,6-beta-glucan. ROT1 is involved in protein folding as a chaperone, participating in various physiological processes including cell wall synthesis and autophagic body lysis. It also regulates actin cytoskeleton polarization at the mother-bud neck and CLB2 protein stability.

Protein Families
ROT1 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein.

Q&A

What is ROT1 and what is its primary function in Saccharomyces cerevisiae?

ROT1 (Reversal of TOR lethality 1) is an essential type-I endoplasmic reticulum (ER) membrane protein in Saccharomyces cerevisiae that functions as a molecular chaperone. It prevents aggregation of unfolded proteins by directly binding to them and supporting their proper folding and assembly. This chaperone activity is critical for the stability and function of several proteins in the secretory pathway. ROT1 exhibits some substrate specificity while maintaining characteristics of a general chaperone, interacting with various protein types including soluble, type I and II, and polytopic membrane proteins that don't necessarily share structural similarities .

How is ROT1 structurally characterized?

ROT1 is characterized as a type-I ER membrane protein containing an N-terminal signal sequence that directs it to the ER and a C-terminal transmembrane domain that anchors it in the ER membrane. The protein undergoes N-glycosylation after translocation into the ER, as demonstrated by endoglycosidase H (EndoH) treatment experiments that increase the protein's mobility on SDS-PAGE . For recombinant protein studies, researchers have successfully generated functional ROT1 by replacing the C-terminal transmembrane region with an HA-His8 tag while maintaining the intact N-terminal signal sequence .

How was the ROT1 gene originally identified?

The ROT1 gene was initially identified in a sectoring screen for mutants requiring Tor1p overexpression for viability. The screening process utilized a red/white sectoring assay with yeast expression plasmids in an ade2 ade3 strain background (YMW1). Cells carrying a plasmid with the ADE3 gene formed red colonies, while those losing the plasmid formed white sectors. By including a Tor1p expression cassette on this plasmid, researchers identified mutants that required Tor1p overexpression for survival, leading to the discovery of ROT1 . Further genetic analysis revealed that the rot1-1 mutation was actually linked to the DNA2 gene, indicating a potential functional relationship between these genes .

What methods are used to express and purify recombinant ROT1 for in vitro studies?

For expression and purification of functional recombinant ROT1, researchers have developed the following protocol:

  • Construct design: The recombinant ROT1 is designed by replacing the C-terminal transmembrane region with an HA-His8 tag while maintaining the intact N-terminal signal sequence.

  • Expression system: The construct is expressed in yeast cells from the strong TDH3 promoter, which ensures sufficient protein production.

  • Purification process:

    • Ni+2-chelated affinity chromatography utilizing the His8 tag

    • Gel filtration for further purification and removal of aggregates

  • Verification of proper processing: EndoH treatment is performed to confirm that the recombinant protein has been properly translocated into the ER and N-glycosylated .

This methodology yields functional ROT1 protein that maintains its antiaggregation activity in vitro, making it suitable for biochemical characterization studies.

How can ROT1's chaperone activity be assessed in vitro?

ROT1's chaperone activity can be evaluated through in vitro aggregation prevention assays:

  • Substrate preparation: Denature model proteins (e.g., α-mannosidase or citrate synthase) using chemical denaturants such as guanidine.

  • Aggregation assay:

    • Rapidly dilute the denatured protein into an assay buffer

    • Monitor protein aggregation by measuring absorbance at 320 nm, which indicates light scattering caused by protein aggregates

    • Compare aggregation profiles in the presence and absence of recombinant ROT1

  • Comparative analysis: Compare the anti-aggregation activity of wild-type ROT1 with mutant versions (e.g., rot1-2) to assess how mutations affect function .

In these experiments, effective chaperones like ROT1 will significantly reduce the measured absorbance, indicating suppression of protein aggregation. The data can be presented as aggregation curves over time, allowing quantitative assessment of chaperone efficiency.

What methodologies are effective for studying ROT1-substrate interactions in vivo?

Several complementary approaches have been developed to investigate ROT1-substrate interactions in vivo:

  • Metabolic labeling with pulse-chase:

    • Label newly synthesized proteins with [35S]Met/Cys

    • Chase with unlabeled amino acids

    • Immunoprecipitate proteins of interest at different time points

    • Analyze by SDS-PAGE and autoradiography to track protein stability

  • Cycloheximide (CHX) chase:

    • Inhibit protein synthesis with CHX

    • Harvest cells at different time points

    • Analyze protein levels by Western blotting

    • Quantify degradation rates with and without functional ROT1

  • Co-immunoprecipitation (coIP):

    • Prepare cell lysates under mild conditions to preserve protein-protein interactions

    • Immunoprecipitate ROT1 or its potential substrate

    • Analyze co-precipitated proteins by Western blotting

    • Compare interaction in wild-type versus rot1-2 mutant backgrounds

  • Sequential coIP:

    • Perform first immunoprecipitation with antibodies against one chaperone (e.g., ROT1)

    • Elute the complexes

    • Perform second immunoprecipitation with antibodies against another chaperone (e.g., BiP)

    • Analyze co-precipitated substrate proteins to detect ternary complexes

These methods have successfully identified several ROT1-dependent substrates and demonstrated the transient nature of ROT1-substrate interactions, which is characteristic of chaperone function.

Which specific proteins depend on ROT1 for proper folding?

Research has identified several proteins in the secretory pathway that depend on ROT1 for proper folding and stability:

ProteinTypeFunctionEvidence for ROT1 Dependence
Big1Type II membrane proteinInvolved in β-1,6-glucan synthesisAccelerated degradation in rot1-2; physical interaction with ROT1; stabilized by ubc7Δ in rot1-2 background
Kre6Type II membrane proteinβ-1,6-glucan synthesisTransient association with newly synthesized Kre6; destabilization in rot1-2
Drs2Polytopic membrane proteinAminophospholipid translocaseDecreased cellular levels in rot1-2
Ces1Secretory proteinCarboxylesteraseDestabilized in rot1-2 mutant
Gas1GPI-anchored proteinβ-1,3-glucanosyltransferaseShown to be affected by rot1-2 mutation

These ROT1-dependent proteins do not share obvious structural similarities, suggesting that ROT1 functions as a general chaperone with some substrate specificity. The substrate proteins exhibit varying degrees of dependence on ROT1, indicating a complex relationship between this chaperone and its client proteins .

How does ROT1 cooperate with other chaperones in the ER?

ROT1 does not function in isolation but cooperates with other chaperones in the ER to facilitate protein folding:

  • Cooperation with BiP: Research has demonstrated that ROT1 can work with BiP (another major ER chaperone) to support protein folding. Sequential co-immunoprecipitation experiments have shown that substrate proteins like Kre6 can simultaneously associate with both ROT1 and BiP, forming a ternary complex .

  • Complementary functions: While both ROT1 and BiP are required for the folding of certain proteins, their specific roles may differ. BiP typically binds to hydrophobic patches on unfolded proteins, while ROT1 may recognize different structural features or assist at different stages of the folding process.

  • Chaperone networks: ROT1 likely functions within a broader network of ER chaperones, including protein disulfide isomerases and other folding factors, that collectively maintain ER proteostasis.

This cooperative model explains why some proteins require multiple chaperones for proper folding and suggests that disruption of one component of this network (e.g., ROT1) can have cascading effects on protein quality control in the secretory pathway.

What is the relationship between ROT1 and the ER-associated degradation (ERAD) pathway?

ROT1 plays an important role in preventing proteins from entering the ERAD pathway:

  • ERAD induction in rot1-2 mutants: The temperature-sensitive rot1-2 mutation causes accelerated degradation of several proteins via the ERAD pathway. This degradation depends on Ubc7, a ubiquitin-conjugating enzyme critical for ERAD function .

  • Quality control mechanism: In wild-type cells, ROT1 supports proper folding of its substrate proteins, preventing them from being recognized by the ERAD machinery. When ROT1 function is impaired, these proteins fail to fold correctly and are targeted for degradation.

  • Experimental evidence: Combining rot1-2 with ubc7Δ (which disrupts ERAD) stabilizes proteins like Big1, demonstrating that these proteins are being degraded through the ERAD pathway when ROT1 function is compromised .

  • Implications for proteostasis: This relationship highlights ROT1's role in the broader context of ER protein quality control, where proper folding (assisted by chaperones) and degradation of misfolded proteins (via ERAD) are balanced to maintain proteostasis.

The link between ROT1 and ERAD provides important insights into how cells determine the fate of proteins in the secretory pathway and how chaperone deficiencies can lead to increased protein degradation.

How do temperature-sensitive ROT1 mutations affect protein function?

Temperature-sensitive mutations in ROT1, particularly rot1-2, have significant effects on both its biochemical and cellular functions:

These findings demonstrate how specific mutations can provide valuable insights into protein function by partially compromising activity rather than eliminating it completely.

What is the genetic relationship between ROT1 and DNA2?

An interesting genetic relationship exists between ROT1 and DNA2:

  • Identification connection: The rot1-1 mutation was found to be linked to DNA2, as demonstrated by genetic linkage analysis. When a strain containing the TRP1 gene integrated at the DNA2 locus was mated to the rot1-1 mutant, all viable spores were TRP1+, indicating tight linkage between the mutation and DNA2 .

  • Functional implications: DNA2 encodes an essential DNA helicase/nuclease involved in Okazaki fragment processing during DNA replication. The connection to ROT1, which functions in the ER as a chaperone, suggests potential unexpected links between ER function and nuclear processes.

  • Suppression relationships: In the genetic screen where rot1-1 was identified, the mutation required Tor1p overexpression for viability . This suggests a functional relationship between ROT1/DNA2, TOR signaling, and potentially ribosome biogenesis or protein synthesis.

While the molecular basis for this genetic relationship remains to be fully elucidated, it highlights the complex interconnections between different cellular processes and suggests that ROT1 may have functions beyond its characterized role as an ER chaperone.

What techniques can advance our understanding of ROT1's substrate recognition mechanism?

Several advanced methodologies could help elucidate how ROT1 recognizes its substrates:

  • Structural biology approaches:

    • X-ray crystallography or cryo-EM of ROT1 alone and in complex with substrate peptides

    • NMR spectroscopy to map substrate binding sites and conformational changes

    • Hydrogen-deuterium exchange mass spectrometry to identify regions involved in substrate interactions

  • Systematic mutational analysis:

    • Alanine scanning mutagenesis of ROT1 to identify critical residues for chaperone function

    • Creation of chimeric proteins with other chaperones to define functional domains

    • Site-directed mutagenesis of specific substrate proteins to determine recognition motifs

  • High-throughput screening:

    • Proteome-wide identification of ROT1 substrates using proximity labeling techniques

    • Synthetic genetic array analysis to identify genetic interactions with rot1 mutations

    • Computational prediction of potential substrates based on identified patterns

These approaches could provide crucial insights into the molecular basis of ROT1's substrate specificity and its role in the broader context of ER protein quality control.

How might ROT1 function be exploited for biotechnological applications?

Understanding ROT1's chaperone function opens possibilities for several biotechnological applications:

  • Protein expression enhancement:

    • Co-expression of ROT1 with difficult-to-express recombinant proteins in yeast systems

    • Engineering of ROT1 variants with broader substrate specificity or enhanced activity

    • Development of ROT1-based fusion tags to improve protein folding and secretion

  • Therapeutic potential:

    • Study of human homologs or functional equivalents of ROT1 for potential disease relevance

    • Design of small molecules that mimic ROT1 activity to improve protein folding in disease states

    • Development of screening systems using ROT1 to identify compounds that enhance protein folding

  • Industrial applications:

    • Improvement of yeast strains for biotechnology by optimizing ROT1 function

    • Enhancement of production of valuable secreted proteins by modulating ROT1 expression

    • Creation of biosensors for protein folding stress based on ROT1-substrate interactions

These potential applications highlight the importance of fundamental research on molecular chaperones like ROT1 for translational outcomes in biotechnology and medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.