Recombinant Saccharomyces cerevisiae Protein RTM1 (RTM1)

Shipped with Ice Packs
In Stock

Description

Functional Role and Mechanisms

Biological function:

  • Confers resistance to molasses toxicity when overexpressed, critical for yeast survival in industrial ethanol production using molasses as a substrate .

  • Found in subtelomeric regions adjacent to SUC loci (genes involved in sucrose metabolism), suggesting co-regulation or functional linkage .

Genomic context:

  • Absent in laboratory strains (e.g., X2180) but amplified in industrial strains due to subtelomeric genomic rearrangements .

  • Co-located with SUC genes between X and Y' subtelomeric repeats, facilitating rapid environmental adaptation .

Industrial Applications

Biotechnological relevance:

  • Enhances yeast tolerance to molasses-derived inhibitors, improving biomass and ethanol yield in fermentations .

  • Genomic amplification of SUC-RTM loci in industrial strains highlights evolutionary adaptation to high-stress environments .

Research Insights and Validation

Key studies:

  • RTM1 identification: Demonstrated its non-essential role in lab strains but critical function in industrial settings .

  • Protein characterization: Hydrophobicity and membrane topology inferred from sequence analysis .

Validation methods:

  • SDS-PAGE and Western blotting likely used to confirm protein size and purity, though specific data are not provided in available sources .

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography to resolve transmembrane domain architecture.

  • Interaction mapping: Identify binding partners using yeast two-hybrid or co-IP assays .

  • Biophysical assays: Assess ion transport or stress-response roles using functional assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes section, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please contact your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term stability, we recommend adding 5-50% glycerol (final concentration) and aliquotting for storage at -20°C/-80°C. Our standard protocol includes 50% glycerol, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is essential. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type is determined during the manufacturing process.
While the tag type is decided during production, we are open to developing specific tags upon request. Please inform us of your desired tag type for prioritization.
Synonyms
RTM1; Protein RTM1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Saccharomyces cerevisiae (Baker's yeast)
Target Names
RTM1
Target Protein Sequence
MSNDSSGSEWELYRYTPSKGAAIALTVLFIVTTLIYSLQVVWDARKASKPEVDNPFDTPV DKCESITAISLGENYKKLTVRSTFSAFIPLFFGCIMEIVGYIARAVSSSNTKEIAPYVIQ AVLLLIAPALYAATIYMLFGRLLHVMRCESLMIVSSRFGTSFFVFGDVVSFCLQAAGGGL MATVNGRTTGSNLITAGLVIQIVFFGVFIINEFRFSYSVARVCPFYRHISKKWWFLNLTL MLSSILIMVRSIVRLVEFVEGYDGFIISHEYFIYVFDAVPMLLAAIVFIVGSFFGNIFTT ITECQSLKP
Uniprot No.

Target Background

Function
Confers resistance to molasses, specifically targeting a toxic element found in certain molasses varieties.
Protein Families
Lipid-translocating exporter (LTE) (TC 9.A.26.1) family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the RTM1 protein in Saccharomyces cerevisiae?

RTM1 is a hydrophobic 34-kD protein containing seven potential transmembrane-spanning segments that confers resistance to the toxicity of molasses when overexpressed in yeast cells . The name RTM1 derives from "Resistance To Molasses," reflecting its functional role in industrial strains of Saccharomyces cerevisiae . This protein represents an excellent model for studying genomic adaptation mechanisms in response to specific environmental conditions, particularly in industrial settings where molasses is used as a substrate .

How does RTM1 differ from other telomeric genes in yeast?

RTM1 belongs to a unique family of telomeric repeated genes in yeast that shows a specific pattern of association with SUC loci . Unlike many other telomeric genes, RTM1 displays variable copy numbers and genomic locations specifically in industrial strains while being completely absent in laboratory strains such as X2180 . The distinct characteristic of RTM1 is its consistent physical association with SUC telomeric loci, with the SUC-RTM sequences positioned between X and Y' subtelomeric sequences at chromosome ends .

Why is RTM1 relevant to yeast research?

RTM1 provides a valuable model for studying genomic evolution and adaptation in industrial yeast strains. Its presence exclusively in industrial yeasts and absence in laboratory strains makes it an excellent marker for tracing evolutionary pathways in response to specific environmental pressures . Additionally, its role in molasses resistance has practical implications for bioethanol production and industrial fermentation processes where molasses serves as a substrate . Understanding RTM1 function offers insights into how nonessential genes can become critical adaptive advantages in specific environments.

What is known about the genomic organization of RTM1?

RTM1 shows a distinctive genomic organization characterized by its telomeric location and association with SUC genes . The SUC-RTM sequences are consistently positioned between X and Y' subtelomeric sequences at chromosome ends, suggesting a specific functional relationship between these elements . Analysis of various industrial strains reveals that RTM1 sequences are present in multiple copies and in variable locations throughout the genome, indicating extensive genomic rearrangement and amplification events . This variability in copy number and position appears to be a genomic adaptation mechanism specific to industrial strains utilizing molasses as a substrate.

What is the protein structure of RTM1 and how does it relate to function?

RTM1 encodes a hydrophobic 34-kD protein containing seven potential transmembrane-spanning segments . This membrane-spanning structure suggests that RTM1 likely functions as a transmembrane protein, potentially involved in transport or sensing mechanisms related to molasses components . The hydrophobic nature and multiple transmembrane domains indicate that RTM1 may be involved in detoxification processes, possibly by preventing cellular uptake of toxic molasses components or facilitating their export from the cell.

How prevalent is RTM1 across different yeast strains?

RTM1 shows a remarkable strain-specific distribution pattern. Analysis of multiple strains demonstrates that RTM1 is consistently present in industrial yeasts used for biomass or ethanol production with molasses as substrate . In contrast, RTM1 sequences are completely absent in laboratory strain X2180, which correlates with the absence of any SUC telomeric gene previously described in this strain . This distribution pattern strongly suggests that RTM1 represents an adaptive acquisition in response to specific industrial cultivation conditions rather than an essential yeast gene.

What are the best methods for detecting and quantifying RTM1 in yeast strains?

For detecting RTM1 in yeast strains, a multi-faceted approach is recommended. Begin with genomic PCR using primers designed from the known RTM1 sequence regions to confirm presence or absence . For quantitative analysis of copy number variation, quantitative PCR (qPCR) provides reliable results when analyzing different industrial strains . Southern blot analysis using labeled RTM1 probes can reveal the genomic distribution pattern and confirm telomeric association . For protein analysis, western blotting with antibodies against the RTM1 protein can confirm expression levels, while GFP-tagging approaches can visualize subcellular localization, which is particularly important given its predicted transmembrane structure.

How can researchers effectively study the functional role of RTM1 in molasses resistance?

To investigate RTM1's functional role in molasses resistance, researchers should employ a systematic approach. First, create gene knockout and overexpression strains in both industrial and laboratory backgrounds . Growth assays in media containing varying concentrations of molasses components can quantify resistance phenotypes. Complementation studies by introducing RTM1 into laboratory strains should confer increased molasses resistance if the gene is solely responsible for this phenotype . Transcriptome analysis comparing wild-type and RTM1-deficient strains under molasses stress can identify downstream pathways. Metabolomic approaches can identify specific molasses components that RTM1 may detoxify or transport. For transmembrane proteins like RTM1, membrane transport assays would be particularly informative for identifying substrate specificity.

What control strains should be used when studying RTM1 function?

When designing experiments to study RTM1 function, appropriate control strains are critical. Laboratory strain X2180, which naturally lacks RTM1, serves as an excellent negative control . Creating isogenic strains that differ only in RTM1 status (presence/absence, copy number, expression level) minimizes confounding variables. For complementation studies, both the empty vector control and RTM1-expression vector should be introduced into the same background strain. When studying industrial strains with multiple RTM1 copies, CRISPR-Cas9 approaches can generate a series of strains with decreasing RTM1 copy numbers to establish dose-dependent relationships. Additionally, strains with mutations in the transmembrane domains of RTM1 can help identify critical functional regions of the protein.

What is the relationship between RTM1 copy number amplification and adaptation to molasses-based media?

The relationship between RTM1 copy number and adaptation to molasses-based media represents a fascinating case of genomic adaptation. RTM1 sequences show amplification specifically in industrial yeasts using molasses as substrate, suggesting selection pressure has favored strains with increased RTM1 dosage . The subtelomeric position of RTM1 likely facilitates this amplification through recombination-based mechanisms common in subtelomeric regions . Research should examine whether higher RTM1 copy numbers correlate directly with increased molasses resistance through quantitative growth assays. Long-term evolution experiments with laboratory strains containing a single RTM1 copy in molasses media could demonstrate if copy number amplification occurs de novo, providing direct evidence of adaptive selection. Comparative genomic analysis across multiple industrial strains could reveal if similar amplification patterns occur independently, indicating convergent evolution.

How does the subtelomeric location of RTM1 influence its amplification and expression?

The subtelomeric location of RTM1 between X and Y' sequences at chromosome ends is likely crucial for its amplification and regulation . Subtelomeric regions experience higher rates of recombination and are known hotspots for gene amplification through unequal crossover events. The consistent association of RTM1 with SUC telomeric loci suggests potential co-regulation or functional interaction . Researchers should investigate whether telomeric silencing mechanisms affect RTM1 expression and whether its proximity to telomeres facilitates rapid evolutionary adaptation through recombination-based copy number variation. Chromatin immunoprecipitation (ChIP) experiments could identify specific chromatin modifications at RTM1 loci and determine if telomere-associated proteins influence RTM1 regulation. Artificially relocating RTM1 to non-telomeric genomic locations would reveal whether its function or amplification potential is dependent on subtelomeric positioning.

What molecular mechanisms underlie the absence of RTM1 in laboratory strains?

The complete absence of RTM1 sequences in laboratory strain X2180 raises intriguing questions about the evolutionary history of this gene . This absence correlates with the lack of any SUC telomeric gene previously described in this strain, suggesting potential co-evolution or related gene loss events . Several potential mechanisms should be investigated: (1) RTM1 may represent a horizontal gene transfer acquired by industrial strains; (2) Laboratory strains may have undergone selective genome streamlining during cultivation on simple media; (3) The absence may reflect the original state, with industrial strains acquiring RTM1 through adaptive mutation. Comparative genomic analysis across diverse Saccharomyces species and strains, including wild isolates, could help reconstruct the evolutionary history of RTM1 acquisition or loss. Dating these events through molecular clock approaches would provide valuable context for understanding when and how RTM1 contributed to yeast adaptation.

How does RTM1 illustrate genomic adaptation in industrial yeast strains?

RTM1 represents an exemplary case of genomic adaptation in response to specific environmental pressures. Its presence exclusively in industrial strains used for biomass or ethanol production with molasses as substrate strongly indicates adaptive selection . The variable copy number and genomic locations demonstrate how subtelomeric regions can serve as "evolutionary playgrounds" where gene amplification and diversification can occur rapidly . This SUC-RTM sequence dispersion provides a clear example of genomic rearrangement playing a direct role in evolution and environmental adaptation in industrial yeasts . The case of RTM1 illustrates how nonessential genes can become crucial adaptive elements when organisms face specific environmental challenges, highlighting the remarkable genomic plasticity that has made Saccharomyces cerevisiae such a successful model organism both in nature and industrial applications.

What does the co-localization of RTM1 with SUC genes suggest about their functional relationship?

The consistent physical association between RTM1 loci and SUC telomeric loci suggests potential functional relationships that merit investigation . SUC genes encode invertase enzymes that hydrolyze sucrose into glucose and fructose. Since molasses contains high levels of sucrose, the co-localization might indicate coordinated roles in sucrose metabolism and molasses utilization . This arrangement could represent a functional gene cluster that enhances fitness in sucrose-rich environments. Several hypotheses should be tested: (1) RTM1 may protect cells from toxic compounds released during SUC-mediated sucrose breakdown; (2) RTM1 might facilitate efficient uptake of sucrose breakdown products; (3) The proteins may physically interact as part of a membrane-associated complex. Experimental approaches should include co-immunoprecipitation studies to detect protein interactions, comparative expression analysis to identify co-regulation patterns, and phenotypic analysis of SUC-RTM1 double mutants to reveal functional interdependence.

What are the implications of RTM1 research for understanding yeast genome evolution and industrial strain improvement?

Research on RTM1 has broad implications for both fundamental understanding of yeast genome evolution and practical applications in industrial strain improvement. From an evolutionary perspective, RTM1 represents a model system for studying how environmental pressures drive genomic adaptation through gene amplification and rearrangement . The subtelomeric location of RTM1 highlights the importance of these regions as hotspots for genomic innovation and adaptation . For industrial applications, understanding RTM1 function could lead to rational engineering of more efficient industrial strains with enhanced tolerance to molasses toxicity. The amplification mechanisms observed with RTM1 could potentially be harnessed as a platform for amplifying other industrially relevant genes. Additionally, the study of RTM1 may provide insights into general mechanisms of stress resistance in yeast that could be applied to other industrial processes beyond molasses fermentation.

What challenges exist in expressing recombinant RTM1 for functional studies?

Expressing recombinant RTM1 presents several challenges stemming from its nature as a hydrophobic transmembrane protein with seven potential membrane-spanning segments . Membrane proteins often face folding issues when overexpressed, potentially forming inclusion bodies or causing cellular toxicity. For functional studies, researchers should consider using expression systems specifically optimized for membrane proteins, such as the yeast Pichia pastoris or mammalian cell lines with inducible expression systems. Fusion tags should be carefully selected—N-terminal tags may be preferable since C-terminal modifications could disrupt membrane insertion. Solubilization and purification will require optimization of detergent conditions to maintain protein stability and function. For structural studies, consider membrane mimetics like nanodiscs or lipid cubic phase crystallization approaches. Expression level verification should employ methods compatible with membrane proteins, such as fluorescent protein tagging for localization or epitope tagging for detection in membrane fractions.

How can genetic diversity of RTM1 across industrial yeast strains be effectively characterized?

Characterizing RTM1 genetic diversity across industrial strains requires a comprehensive approach combining genomic, transcriptomic, and functional analyses. Whole-genome sequencing of diverse industrial strains can identify RTM1 copy number, sequence variations, and genomic locations . Targeted long-read sequencing approaches like Oxford Nanopore or PacBio SMRT sequencing are particularly valuable for resolving repetitive subtelomeric regions where RTM1 resides . For transcriptomic analysis, RNA-Seq under various conditions can reveal strain-specific expression patterns and potential regulatory differences. To assess functional diversity, heterologous expression of RTM1 variants in a common genetic background allows direct comparison of phenotypic effects. Creating a database of RTM1 sequence variants correlated with functional data and strain origins would provide valuable resources for the research community. Finally, population genomics approaches can reconstruct the evolutionary history of RTM1 acquisition, amplification, and diversification across the industrial yeast phylogeny.

What considerations should be made when designing experiments to investigate RTM1's role in molasses detoxification?

When designing experiments to investigate RTM1's role in molasses detoxification, several key considerations must be addressed. First, molasses composition varies significantly by source and processing method, so standardized or defined molasses media should be developed for reproducible results . Since RTM1 encodes a transmembrane protein, studies should focus on transport assays, membrane integrity, and cellular localization under molasses exposure . Control experiments should include both RTM1-containing industrial strains and RTM1-lacking laboratory strains like X2180 . Time-course experiments measuring intracellular and extracellular concentrations of potential toxic compounds can help determine if RTM1 functions in import prevention or export facilitation. Metabolomic approaches comparing wild-type and RTM1-deficient strains exposed to molasses can identify specific compounds affected by RTM1 activity. For a comprehensive understanding, gene expression studies should examine not only RTM1 itself but also global transcriptional responses to determine if RTM1 affects broader cellular pathways involved in stress response or detoxification.

Data Table: RTM1 Characteristics and Related Proteins

Below is a comparative table highlighting key features of RTM1 and related proteins based on available research data:

CharacteristicS. cerevisiae RTM1Arabidopsis RTM1Jacalin-Related Proteins
FunctionResistance to molasses toxicity Restricts long-distance movement of tobacco etch virus Various carbohydrate-binding functions
Protein Size34-kD hydrophobic protein 174 amino acids Varies by specific protein
Structural FeaturesSeven transmembrane-spanning segments Similar to jacalin α-chain β-prism architecture
Genomic LocationSubtelomeric, between X and Y' sequences Chromosome 1 between markers 8H12R and F17J18-M Varies by species
Copy NumberMultiple in industrial strains, absent in laboratory strains Single copyVaries by species and protein
Strain DistributionPresent only in industrial strains using molasses substrate Present in specific Arabidopsis ecotypesFound across plant kingdom
Associated GenesAlways physically associated with SUC telomeric loci Not associated with SUC genesNot typically associated with SUC genes
Evolutionary SignificanceExample of genomic rearrangement for environmental adaptation Involved in virus resistance mechanismsVarious roles in plant defense

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.