Recombinant Saccharomyces cerevisiae Protein SCM4 (SCM4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SCM4; YGR049W; Protein SCM4; Suppressor of CDC4 mutation 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SCM4
Target Protein Sequence
MQVSPAIVKGIAVSSLGLYAGILTSSTVISITTPINVLTQHLKNVLCTLGCWSTVLGGLA TGAFGLSYYLAAPGERPNYLLCGLGVAPLSAAYLYLVSLFNHKLAPKCTRDQNDLEKQKD EKLPQHHPEVKDGEAACPFSKMNNAKTLKPESERSVKCHSYMSLHMSIVTGITIFTFGKC ILDGFKA
Uniprot No.

Target Background

Database Links

KEGG: sce:YGR049W

STRING: 4932.YGR049W

Protein Families
ATG33 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is SCM4 and what is its primary function in yeast cells?

SCM4 (Suppressor of Cell-division-cycle Mutant 4) is a gene in Saccharomyces cerevisiae that encodes a protein which functions as a suppressor of temperature-sensitive alleles of the CDC4 gene . The protein is characterized by a distinct tripartite domain structure where a region rich in charged residues separates two domains of largely uncharged amino acids . Despite its name suggesting critical involvement in cell division, research has shown that SCM4 is not essential for either mitosis or meiosis in yeast, as demonstrated through gene disruption studies . The function of SCM4 appears to be either redundant or part of a network of proteins with overlapping functions, allowing cells to maintain viability even in its absence. The specific interaction between SCM4 and CDC4 seems to be allele-specific, suggesting a direct protein-protein interaction rather than a general regulatory function.

What is the molecular structure and characteristic features of the SCM4 protein?

The SCM4 protein in Saccharomyces cerevisiae has a molecular weight of approximately 20.2 kDa and consists of 187 amino acid residues . Its most notable structural feature is a distinctive tripartite domain arrangement. The protein contains two domains composed predominantly of uncharged amino acids, which are separated by a central region rich in charged residues . This unusual structural arrangement suggests potential roles in protein-protein interactions, particularly with components of the cell division machinery.

The SCM4 gene itself has been cloned on a 1.8 kb BamHI fragment of yeast genomic DNA, and when expressed from a high copy-number vector like pJDB207, results in a 50- to 100-fold increase in the level of its transcript (approximately 700 nucleotides) in vivo compared to endogenous expression levels . This significant increase in expression when overproduced suggests tight regulation under normal conditions and potential functionality when expressed at higher levels, such as suppression of cdc4 mutant phenotypes.

What are the optimal systems for recombinant expression of SCM4 protein?

For recombinant expression of SCM4 protein, the native Saccharomyces cerevisiae system remains one of the most effective platforms. When expressing SCM4 in S. cerevisiae, utilizing a high copy-number vector such as pJDB207 can significantly enhance expression levels, yielding a 50- to 100-fold increase in SCM4 transcript levels compared to endogenous expression . This approach takes advantage of the natural cellular machinery already adapted for proper folding and potential post-translational modifications of yeast proteins.

For secretory expression of recombinant proteins like SCM4 in S. cerevisiae, the selection of appropriate signal peptides (SPs) and translational fusion partners (TFPs) is critical. Recent advancements in yeast modular cloning (MoClo) toolkits have facilitated the efficient incorporation of multiple well-characterized SPs and TFPs into expression cassettes . When designing an expression system for SCM4, researchers should consider testing a panel of signal sequences, as the optimal secretion promoting sequence varies significantly depending on the specific protein of interest . This protein-specific variation in secretion efficiency underscores the importance of empirical testing rather than relying on a one-size-fits-all approach to recombinant protein expression.

How can the yeast modular cloning (MoClo) toolkit be utilized for SCM4 expression?

The yeast modular cloning (MoClo) toolkit provides a sophisticated approach for optimizing SCM4 expression in Saccharomyces cerevisiae. This system utilizes type IIS restriction enzymes to facilitate efficient assembly of expression vectors from standardized parts . Recent expansions of this toolkit have enabled researchers to efficiently incorporate a panel of well-characterized signal peptides (SPs), translational fusion partners (TFPs), and surface display anchor proteins into S. cerevisiae expression cassettes .

For SCM4 expression, the MoClo system allows researchers to rapidly test multiple combinatorial designs by assembling various promoters, signal sequences, and terminators in a standardized fashion. The system particularly excels in the construction of secretory expression cassettes, where up to 16 different well-characterized signal peptides can be systematically evaluated to determine the optimal configuration for SCM4 secretion . The advantage of this approach lies in its modularity—researchers can exchange individual components without redesigning the entire construct, significantly accelerating the optimization process. Additionally, the MoClo system enables seamless fusion of the SCM4 coding sequence without introducing additional amino acids at junction sites that might interfere with protein function or stability. This advantage is particularly relevant when studying proteins like SCM4 where domain structure and interaction interfaces may be sensitive to modifications.

What genetic modifications can enhance SCM4 expression and secretion?

Several genetic modifications have demonstrated significant potential for enhancing recombinant protein expression and secretion in Saccharomyces cerevisiae, which can be applied to SCM4 production. Based on systematic studies of protein secretory pathways, the deletion of specific genes including YPT32, SBH1, and HSP42 has been shown to dramatically increase heterologous protein expression, with observed improvements of 1.92-, 1.66-, and 1.62-fold over wild-type strains, respectively . For SCM4 expression, implementing these deletions could potentially yield similar improvements in protein yields.

Complementary to gene deletions, overexpression of certain components of the secretory pathway can further enhance protein production. Notably, overexpression of IRE1, which mediates the unfolded protein response (UPR) by regulating HAC1 mRNA splicing, has demonstrated a 1.3-fold increase in heterologous protein expression . Additionally, overexpression of OPI1, EPS1, and SSA4 has shown positive effects on protein expression with fold changes of 1.09, 1.14, and 1.16, respectively . Most impressively, the combination of YPT32 deletion with IRE1 overexpression created a synergistic effect, resulting in a 2.12-fold increase in protein expression compared to wild-type strains . This synergistic approach, targeting multiple components of the secretory pathway simultaneously, represents a promising strategy for maximizing SCM4 expression in recombinant systems.

How can signal peptide optimization improve SCM4 secretion efficiency?

Signal peptide optimization is a critical factor in enhancing SCM4 secretion efficiency in Saccharomyces cerevisiae. The selection of appropriate signal peptides is largely empirical, as different proteins respond distinctly to various signal sequences. Studies have shown that signal peptides such as AGA2, CRH1, PLB1, and MF(alpha)1 can significantly enhance secretion of recombinant proteins in yeast compared to wild-type sequences . For SCM4 specifically, systematic testing of multiple signal peptides is advisable to identify the optimal sequence for secretion.

Advanced approaches to signal peptide optimization include the improvement of the α-factor preproleader, which is commonly used for heterologous protein secretion in S. cerevisiae. This can be achieved through parallel engineering strategies: a bottom-up design starting from the native α-factor preproleader (αnat) and a top-down approach beginning with previously evolved signal peptides . Studies have identified synergistic mutations (Aα9D, Aα20T, Lα42S, Dα83E) that, when combined in an optimized leader sequence (αOPT), significantly enhance the secretion of various fungal enzymes . For SCM4, this optimized leader sequence could potentially improve secretion efficiency, especially when combined with appropriate genetic modifications of the host strain. Additionally, combinatorial saturation mutagenesis of specific positions in the signal sequence (such as positions 86 and 87 of the αOPT leader) fused to SCM4 could further fine-tune the secretion process for this specific protein .

What experimental techniques are most effective for studying SCM4 function and interactions?

The study of SCM4 function and interactions requires a multifaceted experimental approach. To investigate the suppressor activity of SCM4 on cdc4 temperature-sensitive mutants, temperature shift assays are particularly valuable. In these experiments, cdc4 mutant strains expressing different levels of SCM4 are cultured at permissive temperatures (typically 25°C) and then shifted to restrictive temperatures (typically 37°C) to observe suppression of the cell cycle arrest phenotype . Microscopic analysis of cell morphology and flow cytometry to assess DNA content can provide quantitative data on the degree of suppression.

For protein-protein interaction studies, techniques such as co-immunoprecipitation and yeast two-hybrid assays are effective in detecting direct interactions between SCM4 and CDC4 or other potential protein partners. The apparent allele specificity of cdc4 suppression strongly suggests direct interaction between the SCM4 and CDC4 proteins , which can be further characterized through these methods. Additionally, modern proximity-based labeling techniques such as BioID or APEX can map the protein interaction landscape of SCM4 within living cells.

To understand the functional redundancy of SCM4, comparative studies with related proteins identified through sequence homology or similar suppressor screens would be informative. Since SCM4 disruption demonstrates that the gene product is not essential for mitosis or meiosis, it likely belongs to a family of related, functionally redundant proteins . Systematic genetic interaction studies, such as synthetic genetic array (SGA) analysis, can reveal genetic relationships and functional connections that illuminate the broader network in which SCM4 operates.

What is the most effective screening system for identifying optimal SCM4 fusion constructs?

For identifying optimal SCM4 fusion constructs, the Signal Peptide Optimization Tool (SPOT) represents an efficient screening system. This method allows for the rapid creation and testing of numerous signal peptide-SCM4 fusion constructs without introducing additional amino acids at the N-terminus of the target protein that might affect its function or conformational stability . The SPOT approach involves generating a library of different signal peptides fused to SCM4 and evaluating their secretion efficiency.

When implementing SPOT for SCM4, researchers should select a diverse panel of signal peptides from S. cerevisiae secretory proteins. Previous studies have successfully utilized libraries of approximately 60 different signal peptides to identify optimal secretion enhancers . The screening process involves transforming the signal peptide-SCM4 fusion library into appropriate yeast strains and quantitatively assessing secretion levels through techniques such as enzyme-linked immunosorbent assay (ELISA), Western blotting, or activity assays if SCM4 has a measurable enzymatic function.

For a more comprehensive analysis, researchers should complement the SPOT approach with systematic knockout studies targeting components of the protein secretory pathway. By expressing SCM4 in various knockout strains, particularly those with deletions in genes related to ER-associated degradation, protein folding, translocation, and unfolded protein response (UPR), researchers can identify genetic backgrounds that enhance SCM4 expression and secretion . The S. cerevisiae BY4741 knockout collection library, which contains 194 single gene deletions in the protein secretory pathway, provides an excellent resource for this approach .

How should researchers analyze and interpret variations in SCM4 expression levels?

When analyzing variations in SCM4 expression levels across different experimental conditions, researchers should implement a systematic approach that accounts for multiple factors affecting protein expression. First, establish reliable quantification methods such as Western blotting with appropriate loading controls, quantitative PCR for transcript levels, or fluorescence-based reporters if using tagged SCM4 constructs. These methods should be calibrated using purified standards where possible to enable absolute quantification rather than relative comparisons.

For statistical analysis of expression data, researchers should perform multiple biological replicates (minimum n=3) and apply appropriate statistical tests based on data distribution. When comparing multiple conditions simultaneously, such as different signal peptides or genetic backgrounds, analysis of variance (ANOVA) followed by post-hoc tests is recommended over multiple t-tests to control for family-wise error rates. Expression fold changes should always be calculated relative to a consistent control condition, preferably wild-type SCM4 expression under standard conditions .

When interpreting results, researchers must consider potential confounding factors such as growth rate differences between strains or toxic effects of overexpression. For instance, while deletion of certain genes like YPT32, SBH1, and HSP42 has been shown to increase heterologous protein expression , these modifications may also affect cellular fitness or cause indirect effects on SCM4 expression. Similarly, when testing different signal peptides, variations in protein processing efficiency rather than transcription or translation rates may be responsible for observed differences in secreted protein levels . Comprehensive analysis should therefore include assessment of intracellular retention, protein degradation rates, and potential misfolding to fully understand the mechanisms underlying expression level variations.

What are the key considerations when designing genetic modifications for enhanced SCM4 production?

The choice between gene deletion versus overexpression should be guided by the functional role of the target gene. For negative regulators of secretion, deletion is typically more effective, while for rate-limiting components, overexpression often yields better results. In some cases, a combination of both approaches can create synergistic effects, as demonstrated by the 2.12-fold increase in protein expression achieved by combining YPT32 deletion with IRE1 overexpression .

Researchers must also consider potential unintended consequences of genetic modifications. For example, deletion of genes involved in fundamental cellular processes like OPI1, BCK1, EPS1, IRE1, and SSA4 has been shown to decrease expression of certain proteins . These genes play crucial roles in endoplasmic reticulum UPR and protein folding, and their deletion may impact cellular fitness or create bottlenecks elsewhere in the secretory pathway. Therefore, a balanced approach that considers both enhancement of rate-limiting steps and maintenance of essential cellular functions is necessary.

How does SCM4 compare with other secretory proteins in Saccharomyces cerevisiae?

SCM4 belongs to a broader network of proteins in Saccharomyces cerevisiae that exhibit functional relationships with cell cycle progression. Unlike many essential cell cycle proteins, SCM4 is not required for normal mitotic or meiotic progression, as demonstrated by viability of strains with SCM4 disruption . This suggests SCM4 likely belongs to a family of functionally redundant proteins that collectively contribute to cell cycle regulation, providing robustness to the system through overlapping functions .

When comparing SCM4 to well-characterized secretory proteins in yeast, several distinctions emerge. Unlike proteins such as the α-factor mating pheromone, which has been extensively studied as a model for protein secretion and used as a fusion partner for heterologous protein expression, SCM4 has not been traditionally employed as a secretion enhancer . The tripartite domain structure of SCM4, featuring a charged central region between two uncharged domains , differs from typical secretory proteins that often contain hydrophobic signal sequences followed by folded functional domains.

In terms of genetic regulation and response to cellular stress, SCM4 does not appear to be strongly regulated by the unfolded protein response (UPR) pathway, which controls many secretory proteins. In contrast, genes like IRE1, OPI1, and SSA4 play crucial roles in UPR and significantly influence heterologous protein expression . This suggests that SCM4 expression may be regulated through alternative mechanisms, potentially linked to cell cycle progression rather than secretory pathway stress.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.