Recombinant Saccharomyces cerevisiae Protein SEY1 (SEY1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Protein SEY1 (SEY1)

Recombinant Saccharomyces cerevisiae Protein SEY1, commonly referred to as Sey1p, is a dynamin-like GTPase that plays a crucial role in mediating homotypic endoplasmic reticulum (ER) fusion in the yeast Saccharomyces cerevisiae. This protein is analogous to mammalian atlastins (ATLs), which are essential for maintaining ER morphology and facilitating ER fusion in metazoans .

Function and Mechanism of SEY1

SEY1 is involved in the fusion of ER tubules, a process necessary for maintaining the tubular ER network. It functions by undergoing GTP-dependent dimerization, similar to ATLs, which initiates a conformational change that pulls opposing membranes together, facilitating their fusion . The absence of SEY1 results in delayed ER fusion and altered ER morphology, characterized by a reduction in ER tubules and an increase in ER sheets .

FeatureDescription
Protein TypeDynamin-like GTPase
FunctionMediates homotypic ER fusion
MechanismGTP-dependent dimerization and membrane fusion
LocalizationTubular ER
InteractionsInteracts with Rtn1p and Yop1p

Table: Comparison of SEY1 and ATL1

CharacteristicsSEY1ATL1
OrganismS. cerevisiaeMammals
FunctionHomotypic ER fusionHomotypic ER fusion
MechanismGTP-dependent dimerizationGTP-dependent dimerization
StructureLonger helical bundle domainShorter helical bundle domain
LocalizationTubular ERTubular ER

Applications and Future Directions

While SEY1 itself is not directly applied in biotechnology or medicine, understanding its role in ER fusion can provide insights into cellular processes and potentially inform strategies for manipulating ER morphology in various organisms. The study of SEY1 and its mammalian counterparts could also shed light on diseases related to ER dysfunction.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SEY1; SCY_5228; Protein SEY1; Synthetic enhancer of YOP1 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-776
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain YJM789) (Baker's yeast)
Target Names
SEY1
Target Protein Sequence
MADRSAIQLIDEEKEFHQSALQYFQQCIGNRDVGLDYHVISVFGSQSSGKSTLLNVLFNT NFDTMDAQVKRQQTTKGIWLAHTKQVNTTIEIDNDRPDIFVLDVEGSDGSERGEDQDFER KAALFAIAVSEVLIVNMWEQQIGLYQGNNMALLKTVFEVNLSLFGKNDNDHKVLLLFVIR DHVGVTPLSSLSDSVTRELEKIWTELSKPAGCEGSSLYDYFDLKFVGLAHKLLQEDKFTQ DVKKLGDSFVMKGTENYYFKPQYHHRLPLDGWTMYAENCWDQIERNKDLDLPTQQILVAR FKTEEISNEALEEFISKYDESIAPLKGNLGSLTSQLVKLKEECLTKYDEQASRYARNVYM EKREALNTKLNSHISGTINEFLESLMEKLWDDLKLEVSSRDKATTSFVESVAAGKSKIEK EFNESMETFKKLGLLISNEEITCKFSDDIEERIKQLCDAELKAKIGRIKKNLVPELKDHV IHLLSHPSKKVWDDIMNDFESTIKDNISAYQVEKDKYDFKIGLSESENAKIYKNIRILAW RTLDTTVHDYLKIDTIVSILRDRFEDVFRYDAEGSPRLWKTEEEIDGAFRVAKEHALEVF EVLSLAVTSDNVEIIPDVPMAEEESGEDNEIYRDNEGVFHSRRFAHILTELQKENVLDQF RRQINITVLDSKRSIITTRTHIPPWIYVLLAVLGWNEFVAVIRNPLFVTLTLILGATFFV IHKFGLWGPVVNVVQSAVGETRTAIKDKLRQFVVEDHEVKESFEMKDFSKNEQKEK
Uniprot No.

Target Background

Function

SEY1 protein cooperates with reticulon proteins RTN1 and RTN2, and the tubule-shaping DP1 family protein YOP1 to generate and maintain the structure of the tubular endoplasmic reticulum network. Its GTPase activity is essential for this function in ER organization.

Protein Families
TRAFAC class dynamin-like GTPase superfamily, GB1/RHD3-type GTPase family, RHD3 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is SEY1 protein and what is its primary function in Saccharomyces cerevisiae?

SEY1 (Synthetic enhancer of YOP1) is a dynamin-like GTPase in Saccharomyces cerevisiae that mediates homotypic endoplasmic reticulum fusion. Its structure consists of a dynamin-like GTPase domain with characteristic signature motifs, a helical bundle domain (which is notably longer than that of mammalian atlastins), two closely spaced transmembrane segments, and a C-terminal tail. SEY1 localizes to the tubular ER and physically interacts with tubule-shaping proteins Rtn1p and Yop1p, which are homologues of reticulons and DP1, respectively .

The primary function of SEY1 is to mediate ER-ER fusion through a GTP-dependent mechanism. This function is analogous to that of atlastins (ATLs) in mammalian cells, although no organism appears to possess both ATL and SEY1 homologues. SEY1 represents the functional orthologue of ATLs in yeast cells, with RHD3 serving a similar function in Arabidopsis thaliana .

How does SEY1 differ structurally and functionally from mammalian atlastins?

While SEY1 and mammalian atlastins (ATLs) perform analogous functions in ER fusion, there are notable structural differences. Both proteins contain a dynamin-like GTPase domain, but SEY1's helical bundle domain is significantly longer than that found in ATLs. This structural difference may impact the specific conformational changes that occur during the fusion process .

Functionally, both proteins mediate ER fusion through GTP-dependent dimerization, but the exact conformational changes during the fusion process may differ due to the structural variations. Despite these differences, human ATL1 can partially restore the ER tubular network when expressed in sey1Δ yop1Δ yeast cells, indicating functional conservation across species .

Another key functional distinction is that SEY1 operates in a system with redundant fusion mechanisms. In Saccharomyces cerevisiae, an alternative ER fusion pathway exists that involves ER SNAREs (particularly Ufe1p), providing a backup mechanism in the absence of SEY1 .

What is the recommended protocol for reconstituting recombinant SEY1 protein?

For optimal reconstitution of recombinant SEY1 protein, the following protocol is recommended:

  • Briefly centrifuge the vial containing lyophilized protein before opening to ensure all contents are at the bottom.

  • Reconstitute the protein in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% (with 50% being the default recommendation) to enhance stability during storage.

  • Aliquot the reconstituted protein to avoid repeated freeze-thaw cycles.

  • Store working aliquots at 4°C for up to one week.

  • For long-term storage, keep aliquots at -20°C/-80°C, where liquid form has a shelf life of approximately 6 months and lyophilized form can be stored for up to 12 months .

This reconstitution method helps maintain protein stability and activity for subsequent experimental applications.

How can researchers design effective in vitro experiments to study SEY1-mediated membrane fusion?

To effectively study SEY1-mediated membrane fusion in vitro, researchers should consider the following experimental design:

Proteoliposome Preparation:

  • Purify recombinant SEY1 protein to >85% purity using SDS-PAGE verification .

  • Incorporate purified SEY1 into liposomes with a lipid composition mimicking the ER membrane.

  • For control experiments, prepare liposomes containing the GTPase-defective mutant SEY1-K50A or no SEY1.

Fusion Assay Setup:

  • Label one population of proteoliposomes with fluorescent lipid donors and another with acceptors.

  • Mix the two populations and monitor fluorescence changes that occur upon lipid mixing during fusion.

  • Include conditions with and without GTP to demonstrate the GTP-dependence of the fusion reaction.

  • Test fusion between proteoliposomes containing wild-type SEY1 and those containing mutant SEY1-K50A to evaluate interaction requirements .

Data Analysis:

  • Quantify fusion rates under different conditions.

  • Compare fusion efficiency between wild-type SEY1 and mutant SEY1-K50A proteoliposomes.

  • Assess the impact of GTP concentration on fusion rates.

This experimental design allows researchers to directly observe and quantify SEY1-mediated membrane fusion, providing insights into the mechanisms and requirements of this process .

What are the appropriate controls when studying SEY1 function in yeast cells?

When studying SEY1 function in yeast cells, several control conditions are essential to ensure experimental validity:

Genetic Controls:

  • Wild-type strain (positive control for normal ER morphology and function)

  • sey1Δ single deletion mutant (to assess redundant mechanisms)

  • sey1Δ yop1Δ or sey1Δ rtn1Δ double mutants (to observe enhanced ER morphology defects)

  • ufe1-1 temperature-sensitive mutant (to study the alternative ER fusion pathway)

  • ufe1-1 sey1Δ double mutant (to observe synthetic growth defects when both pathways are compromised)

Functional Complementation Controls:

  • sey1Δ or sey1Δ yop1Δ cells expressing wild-type SEY1 from a plasmid (rescue control)

  • sey1Δ or sey1Δ yop1Δ cells expressing GTPase-defective SEY1 mutant (negative control)

  • sey1Δ or sey1Δ yop1Δ cells expressing human ATL1 (cross-species complementation control)

Visualization Controls:

  • Include ER markers such as Sec63-GFP to visualize ER morphology

  • Use time-lapse imaging to monitor dynamic changes in ER structure

  • Apply quantitative analysis to measure tubule-to-sheet ratios objectively

These controls help distinguish between direct effects of SEY1 manipulation and potential secondary effects due to other factors, ensuring proper interpretation of experimental results .

How can researchers effectively measure GTP-dependent dimerization of SEY1?

Measuring GTP-dependent dimerization of SEY1 requires specialized techniques and careful experimental design:

In Vitro Approaches:

  • Size Exclusion Chromatography (SEC):

    • Incubate purified SEY1 with either GTP, GDP, or non-hydrolyzable GTP analogs

    • Run samples through SEC columns to separate monomeric and dimeric forms

    • Analyze elution profiles to quantify the proportion of dimers under each condition

  • Förster Resonance Energy Transfer (FRET):

    • Label SEY1 proteins with donor and acceptor fluorophores

    • Mix labeled proteins and monitor FRET signal changes upon GTP addition

    • Calculate dimerization rates and efficiencies based on FRET measurements

  • Analytical Ultracentrifugation:

    • Subject SEY1 samples with and without GTP to analytical ultracentrifugation

    • Determine sedimentation coefficients to identify monomeric and dimeric species

In Vivo Approaches:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Create split-fluorescent protein fusions with SEY1

    • Express in yeast cells and measure fluorescence reconstitution upon dimerization

    • Compare wild-type SEY1 with GTPase-defective mutants

  • Split-Ubiquitin Assay:

    • Fuse SEY1 to split-ubiquitin components

    • Measure reporter gene activation upon SEY1 dimerization

    • Test dependency on GTP by using GTPase-defective mutants

These approaches allow researchers to quantitatively assess the GTP dependency of SEY1 dimerization, which is critical for understanding the mechanism of SEY1-mediated ER fusion .

How do SEY1 and SNARE proteins coordinate to maintain ER network integrity in yeast?

The coordination between SEY1 and SNARE proteins in maintaining ER network integrity involves complex redundant mechanisms:

Dual Fusion Pathways:
SEY1 and ER SNAREs (particularly Ufe1p) represent two parallel mechanisms for ER membrane fusion in yeast. Experimental evidence shows that while cells lacking SEY1 (sey1Δ) show normal growth and only subtle ER morphology defects, combining SEY1 deletion with mutations in ER SNAREs causes dramatic synthetic growth defects. For example, although ufe1-1 cells grow relatively normally at permissive temperatures, ufe1-1 sey1Δ double mutants grow very poorly, indicating that the two proteins function in parallel pathways that can compensate for each other .

Genetic Interactions and Functional Hierarchy:
Similar genetic interactions have been observed between SEY1 and other essential ER SNAREs including USE1 and SEC20, suggesting a network-wide redundancy. Interestingly, no genetic interaction was detected between SEY1 and the non-essential ER SNARE SEC22, indicating specificity in these functional relationships .

Temporal Dynamics:
In cells lacking SEY1, homotypic ER fusion still occurs but with delayed kinetics, suggesting that the SNARE-mediated pathway may be slower but still functional. This temporal aspect is important for understanding how these mechanisms may be differentially regulated or activated under various cellular conditions .

Model for Coordination:
The current model suggests that SEY1-mediated fusion is the primary, more efficient mechanism for maintaining ER network connectivity, while the SNARE-mediated pathway serves as a backup system. Under normal conditions, both pathways likely operate simultaneously, with their relative contributions potentially varying based on cellular needs or stress conditions .

Understanding this coordination requires integrated approaches combining genetic manipulations, live cell imaging, and in vitro reconstitution to dissect the specific contributions of each pathway.

What are the critical experimental considerations when comparing SEY1 and atlastin functions in heterologous systems?

When comparing SEY1 and atlastin functions in heterologous systems, researchers must address several critical experimental considerations:

Protein Expression Levels:

  • Ensure comparable expression levels of SEY1 and atlastins to avoid artifacts from overexpression

  • Use quantitative Western blotting to normalize expression levels

  • Consider using endogenous promoters or regulated expression systems

Subcellular Localization:

  • Verify proper ER localization of both proteins using high-resolution microscopy

  • Assess interaction with native ER-shaping proteins in the heterologous system

  • Consider potential differences in membrane insertion and topology

Functional Readouts:

  • Use multiple complementary assays to measure ER fusion (morphological analysis, in vivo fusion assays, in vitro liposome fusion)

  • Apply quantitative metrics rather than qualitative observations

  • Establish appropriate positive and negative controls specific to each system

Genetic Background Considerations:

  • When expressing human ATL1 in yeast, use sey1Δ yop1Δ double mutants to clearly observe rescue effects

  • Consider the presence of endogenous proteins that might interact differently with SEY1 versus atlastins

  • For cross-species studies, account for differences in membrane composition and cellular environment

GTPase Activity Assessment:

  • Use comparable methods to measure GTPase activity across systems

  • Consider potential differences in cofactors or regulators between systems

  • Engineer equivalent mutations (e.g., in the GTPase domain) for fair comparisons

By carefully addressing these considerations, researchers can make valid comparisons between SEY1 and atlastin functions across different cellular contexts .

How can researchers resolve contradictory data regarding SEY1's role in ER morphology versus ER fusion?

Resolving contradictory data regarding SEY1's role in ER morphology versus ER fusion requires a systematic approach:

Experimental Strategy for Resolution:

  • Separate Functional Domains:

    • Generate SEY1 mutants with specific alterations in different functional domains

    • Create chimeric proteins combining domains from SEY1 and atlastins

    • Test these constructs for their ability to restore ER morphology and fusion independently

  • Temporal Analysis:

    • Use high-speed, high-resolution live cell imaging to establish the temporal sequence of events

    • Determine whether fusion defects precede morphology changes or vice versa

    • Develop acute inhibition methods (e.g., rapid protein degradation systems) to observe immediate effects

  • Quantitative Phenotyping:

    • Develop objective, quantitative metrics for both ER morphology and fusion

    • Apply computational image analysis to eliminate observer bias

    • Create standardized assays that can be reproduced across different laboratories

  • Context Dependency:

    • Test SEY1 function under different cellular conditions (e.g., ER stress, cell cycle stages)

    • Examine genetic interactions systematically with both morphology and fusion factors

    • Consider tissue or cell-type specific factors when working with higher eukaryotes

  • In Vitro Reconstitution:

    • Develop minimal systems that recapitulate either morphology or fusion

    • Add components systematically to identify factors that might reconcile contradictory observations

    • Test whether protein concentration or membrane composition affects functional outcomes

Reconciliation Framework:
The apparent contradictions might be resolved by recognizing that ER morphology and fusion are interconnected processes. SEY1's primary role may be in fusion, but this directly impacts morphology since fusion is required for network maintenance. Similarly, interactions with morphology factors (Rtn1p, Yop1p) might position SEY1 optimally for fusion events .

A comprehensive model incorporating both functions would suggest that SEY1 acts at the intersection of these processes, with its precise role depending on cellular context and experimental conditions.

What are the optimal conditions for in vitro reconstitution of SEY1-mediated membrane fusion?

Optimizing conditions for in vitro reconstitution of SEY1-mediated membrane fusion requires careful attention to multiple parameters:

Protein Preparation:

  • Purify SEY1 to >85% homogeneity using appropriate chromatography techniques and verify by SDS-PAGE

  • Maintain protein in a buffer containing stabilizing agents to prevent aggregation

  • Use freshly reconstituted protein whenever possible, as activity may decrease with storage

Proteoliposome Formation:

  • Lipid Composition: Use a mixture mimicking the ER membrane (typically phosphatidylcholine, phosphatidylethanolamine, phosphatidylserine, and phosphatidylinositol at physiologically relevant ratios)

  • Protein:Lipid Ratio: Optimize between 1:200 and 1:1000 (mol:mol) to achieve efficient incorporation while maintaining physiological density

  • Size: Control liposome size (typically 100-200 nm) using extrusion through polycarbonate filters

Fusion Reaction Conditions:

  • Buffer: 25-50 mM Tris-HCl or HEPES (pH 7.4), 100-150 mM KCl, 1-5 mM MgCl₂

  • Temperature: 30°C (optimal for yeast proteins)

  • GTP Concentration: 1-2 mM GTP, freshly prepared

  • Time Course: Monitor fusion for at least 60 minutes to capture both initial rates and plateau

Detection Methods:

  • Lipid Mixing Assay: Use fluorescently labeled lipids (NBD/Rhodamine pairs) in donor liposomes to monitor lipid mixing upon fusion

  • Content Mixing Assay: Encapsulate fluorophore/quencher pairs to verify complete fusion rather than just hemifusion

Critical Controls:

  • GTP-free reaction to establish baseline

  • Non-hydrolyzable GTP analogs to distinguish between GTP binding and hydrolysis requirements

  • GTPase-defective SEY1 mutant (e.g., SEY1-K50A)

  • Reactions between proteoliposomes containing SEY1 and plain liposomes (should show minimal fusion)

These optimized conditions allow for reliable and reproducible assessment of SEY1's fusion activity in a controlled in vitro system.

How can researchers effectively analyze the dynamics of SEY1-mediated ER remodeling using advanced imaging techniques?

Analyzing the dynamics of SEY1-mediated ER remodeling requires sophisticated imaging approaches:

Live Cell Imaging Setups:

  • Super-Resolution Microscopy:

    • Stimulated Emission Depletion (STED) microscopy to resolve fine ER tubular structures below the diffraction limit

    • Structured Illumination Microscopy (SIM) for improved resolution while maintaining reasonable acquisition speeds

    • Single Molecule Localization Microscopy (PALM/STORM) for nanoscale mapping of SEY1 distribution

  • High-Speed Confocal Microscopy:

    • Spinning disk confocal systems for rapid acquisition (>10 frames per second)

    • Resonant scanner confocal systems to capture millisecond-scale fusion events

    • Multi-position imaging to increase statistical power

  • Multi-Color Imaging:

    • Dual labeling of SEY1 and ER markers (e.g., Sec63-GFP)

    • Additional channels for markers of fusion sites or interacting proteins

    • Spectral unmixing to minimize bleed-through in closely related fluorophores

Quantitative Analysis Approaches:

  • Automated Tracking and Analysis:

    • Machine learning algorithms to identify and classify ER structures

    • Particle tracking to follow individual fusion events

    • Skeleton analysis to quantify network connectivity changes

  • Fluorescence Dynamics Measurements:

    • Fluorescence Recovery After Photobleaching (FRAP) to measure SEY1 mobility

    • Fluorescence Correlation Spectroscopy (FCS) to assess SEY1 diffusion and clustering

    • Förster Resonance Energy Transfer (FRET) to detect SEY1 dimerization in vivo

  • Morphological Quantification:

    • Tubule-to-sheet ratio measurements

    • Junction analysis to quantify three-way junctions characteristic of ER networks

    • Persistent homology analysis for topological characterization of network changes

Experimental Design Considerations:

  • Use temperature-sensitive SEY1 mutants for acute inactivation during imaging

  • Employ optogenetic approaches to locally activate or inactivate SEY1

  • Implement correlative light and electron microscopy to connect dynamic events with ultrastructural changes

These advanced imaging approaches allow researchers to measure the kinetics, spatial organization, and morphological consequences of SEY1-mediated ER remodeling with unprecedented detail and precision .

What approaches can be used to identify and characterize novel regulatory partners of SEY1?

Identifying and characterizing novel regulatory partners of SEY1 requires a multi-faceted approach:

Unbiased Screening Methods:

  • Genome-Wide Genetic Interaction Screening:

    • Synthetic genetic array (SGA) analysis using sey1Δ strains

    • Generate double mutants with each non-essential yeast gene

    • Identify suppressors and enhancers of sey1Δ phenotypes

    • Focus particularly on genes that suppress the synthetic growth defects of sey1Δ ufe1-1 mutants

  • Proximity-Dependent Labeling:

    • Express SEY1 fused to BioID or TurboID in yeast

    • Identify proteins that become biotinylated due to proximity to SEY1

    • Use mass spectrometry to create an unbiased proximity interaction map

  • Co-Immunoprecipitation Coupled with Mass Spectrometry:

    • Perform immunoprecipitation of tagged SEY1 under various conditions

    • Include crosslinking approaches to capture transient interactions

    • Compare interactomes with and without GTP to identify nucleotide-dependent interactions

Validation and Characterization Approaches:

  • Targeted Genetic Interaction Analysis:

    • Create double mutants between sey1Δ and candidates from screens

    • Perform epistasis analysis to determine functional relationships

    • Test genetic interactions in different stress conditions

  • Co-Localization Studies:

    • Perform multi-color imaging of SEY1 and candidate partners

    • Use super-resolution microscopy to confirm spatial proximity

    • Analyze co-localization dynamics during ER remodeling events

  • Biochemical Interaction Characterization:

    • Perform in vitro binding assays with purified components

    • Determine binding affinities and kinetics

    • Map interaction domains through truncation and point mutation analysis

  • Functional Assays:

    • Assess the impact of candidate regulators on SEY1 GTPase activity

    • Determine effects on SEY1-mediated fusion in vitro and in vivo

    • Test whether candidates affect SEY1 dimerization or conformational changes

Bioinformatic Approaches:

  • Look for conserved interaction partners between SEY1 and mammalian atlastins

  • Perform structural modeling to predict potential interaction surfaces

  • Use evolutionary coupling analysis to identify co-evolving residues that might indicate functional interactions

Through these complementary approaches, researchers can build a comprehensive map of the SEY1 regulatome, providing insights into how this GTPase is controlled in different cellular contexts.

What are the common challenges in expressing and purifying active recombinant SEY1 protein?

Expressing and purifying active recombinant SEY1 protein presents several challenges that researchers should anticipate and address:

Expression Challenges:

  • Membrane Protein Solubility:

    • SEY1 contains transmembrane domains that complicate expression and purification

    • Solution: Express truncated versions lacking transmembrane domains for soluble protein, or use specialized detergent-based systems for full-length protein

  • Toxicity to Expression Host:

    • Overexpression of membrane proteins can disrupt host membrane integrity

    • Solution: Use tightly regulated inducible expression systems and optimize induction conditions (lower temperature, reduced inducer concentration)

  • Proper Folding:

    • GTPases often require chaperones for proper folding

    • Solution: Co-express with yeast chaperones or use yeast expression systems rather than bacterial hosts

Purification Challenges:

  • Detergent Selection:

    • Different detergents affect protein stability and activity

    • Solution: Screen multiple detergents (DDM, LMNG, CHAPS) for optimal extraction and stability

  • Maintaining GTPase Activity:

    • GTPase domains are sensitive to buffer conditions

    • Solution: Include stabilizing agents (glycerol at 5-50%, reducing agents) in all buffers

  • Preventing Aggregation:

    • Membrane proteins tend to aggregate during concentration steps

    • Solution: Add glycerol (5-50%) to all buffers and minimize concentration steps

Quality Control Metrics:

  • Purity Assessment:

    • Aim for >85% purity by SDS-PAGE

    • Verify single peak by size exclusion chromatography

  • Activity Testing:

    • Measure GTP hydrolysis rates using malachite green phosphate assays

    • Compare activity to published values or wild-type controls

  • Structural Integrity:

    • Perform circular dichroism to confirm secondary structure

    • Use tryptophan fluorescence to assess tertiary structure

Storage Considerations:

  • Store protein with 5-50% glycerol to prevent aggregation

  • Aliquot to avoid repeated freeze-thaw cycles

  • For liquid preparations, expect a shelf life of 6 months at -20°C/-80°C; for lyophilized preparations, up to 12 months

By systematically addressing these challenges, researchers can obtain high-quality, active SEY1 protein suitable for downstream applications.

How can researchers interpret and resolve contradictory results in SEY1 functional studies?

Interpreting and resolving contradictory results in SEY1 functional studies requires a systematic troubleshooting approach:

Common Sources of Contradictions and Resolution Strategies:

  • Genetic Background Variations:

    • Problem: Different yeast strain backgrounds can influence SEY1 phenotypes.

    • Resolution: Standardize genetic backgrounds or perform complementary experiments in multiple strains. Document strain genotypes completely.

    • Validation: Reintroduce wild-type SEY1 to confirm phenotype rescue in all backgrounds.

  • Redundant Mechanisms:

    • Problem: SEY1 functions in parallel with SNARE-mediated ER fusion, creating context-dependent results.

    • Resolution: Always examine SEY1 function in both wild-type and sensitized backgrounds (e.g., compromised SNARE function).

    • Validation: Use double mutant analysis (e.g., sey1Δ ufe1-1) to reveal functions masked by redundancy .

  • Assay Sensitivity and Specificity:

    • Problem: Different assays measure different aspects of SEY1 function with varying sensitivity.

    • Resolution: Use multiple complementary assays (morphological, biochemical, genetic) to assess function.

    • Validation: Develop quantitative metrics for each assay and establish detection limits.

  • Protein Expression Levels:

    • Problem: Overexpression or insufficient expression can generate artifacts.

    • Resolution: Use endogenous promoters when possible or titrate expression carefully.

    • Validation: Quantify protein levels by Western blot and correlate with observed phenotypes.

Systematic Reconciliation Approach:

  • Parameter Mapping:
    Create a comprehensive table mapping experimental conditions across contradictory studies:

    ParameterStudy AStudy BPotential Impact
    Strain backgroundW303S288CDifferent genetic modifiers
    Temperature30°C25°CAltered protein dynamics
    Growth phaseLogStationaryChanged membrane composition
    Assay timingAcuteChronicAdaptation mechanisms
  • Bridging Experiments:
    Design experiments that systematically vary conditions between contradictory studies to identify critical parameters causing differences.

  • Epistasis Analysis:
    Use genetic approaches to determine the relationship between SEY1 and other factors that might explain context-dependent results .

  • Quantitative Modeling:
    Develop mathematical models incorporating multiple parameters to predict conditions under which different outcomes would be expected.

By applying these systematic approaches, researchers can transform contradictory results into deeper insights about context-dependent functions of SEY1 in different cellular environments.

What strategies can be employed to overcome technical limitations in studying SEY1 and ER dynamics?

Overcoming technical limitations in studying SEY1 and ER dynamics requires innovative approaches across multiple fronts:

Imaging Limitations and Solutions:

  • Resolution Barriers:

    • Limitation: Standard light microscopy cannot resolve fine ER structures.

    • Solution: Implement super-resolution techniques (STED, SIM, PALM/STORM) specialized for membrane visualization.

    • Advanced approach: Develop expansion microscopy protocols optimized for ER imaging.

  • Temporal Resolution Challenges:

    • Limitation: Fusion events occur rapidly, often faster than conventional imaging.

    • Solution: Use high-speed spinning disk or swept-field confocal microscopy.

    • Advanced approach: Implement stroboscopic illumination to capture millisecond-scale events.

  • Phototoxicity During Long-Term Imaging:

    • Limitation: Extended imaging damages cells and alters ER dynamics.

    • Solution: Use lattice light-sheet microscopy for reduced photodamage.

    • Advanced approach: Implement adaptive imaging with smart illumination strategies.

Biochemical and Functional Assay Limitations:

  • Membrane Reconstitution Challenges:

    • Limitation: Artificial membranes may not recapitulate native ER properties.

    • Solution: Use lipid mixtures extracted from yeast ER or systematically vary compositions.

    • Advanced approach: Develop supported bilayers with integrated ER-derived microsomes.

  • Measuring Fusion Events In Vitro:

    • Limitation: Standard lipid mixing assays cannot distinguish hemifusion from complete fusion.

    • Solution: Implement dual-label content mixing assays.

    • Advanced approach: Develop single-vesicle fusion assays with TIRF microscopy visualization.

Genetic Tool Limitations:

  • Functional Redundancy Masking Phenotypes:

    • Limitation: SNARE-mediated fusion compensates for SEY1 loss.

    • Solution: Use sensitized backgrounds (e.g., temperature-sensitive SNARE mutants) .

    • Advanced approach: Develop systems for simultaneous acute inactivation of multiple pathways.

  • Protein Manipulation Specificity:

    • Limitation: Global gene deletion affects all cellular pools of SEY1.

    • Solution: Use location-specific protein inactivation techniques.

    • Advanced approach: Implement optogenetic tools for spatiotemporal control of SEY1 activity.

Emerging Technologies to Consider:

  • Correlative Light-Electron Microscopy (CLEM):
    Combine live fluorescence imaging with electron microscopy to correlate dynamics with ultrastructure.

  • Genome Editing with Minimal Perturbation:
    Use CRISPR-based approaches for endogenous tagging of SEY1 without overexpression artifacts.

  • Microfluidics and Mechanical Manipulation:
    Develop systems to physically manipulate ER membranes while monitoring SEY1 responses.

  • Computational Modeling and Simulation:
    Create predictive models of ER network dynamics incorporating SEY1 activity parameters.

By implementing these advanced strategies, researchers can overcome current technical limitations and gain unprecedented insights into SEY1 function and ER dynamics.

What emerging techniques could revolutionize our understanding of SEY1's role in membrane dynamics?

Several cutting-edge techniques are poised to transform our understanding of SEY1's role in membrane dynamics:

Cryo-Electron Microscopy (Cryo-EM) Applications:

  • High-Resolution Structural Studies: Determine the complete structure of SEY1 in different nucleotide-bound states to understand conformational changes during the fusion cycle.

  • In Situ Structural Biology: Use cryo-electron tomography with subtomogram averaging to visualize SEY1 in its native membrane environment.

  • Membrane Remodeling Visualization: Capture intermediate states of SEY1-mediated membrane deformation and fusion.

Advanced Optical Techniques:

  • Single-Molecule Tracking: Apply sptPALM (single-particle tracking photoactivated localization microscopy) to track individual SEY1 molecules in living cells, revealing dynamics and clustering behavior.

  • Expansion Microscopy for ER: Develop ER-specific expansion microscopy protocols to physically enlarge ER structures for improved resolution in conventional microscopes.

  • Light-Sheet Microscopy Innovations: Implement lattice light-sheet microscopy with adaptive optics for high-speed, low-phototoxicity 4D imaging of ER dynamics.

Synthetic Biology Approaches:

  • Minimal ER Reconstitution: Build synthetic minimal ER systems with defined components to determine the minimal machinery required for SEY1-mediated fusion.

  • Engineered Orthogonal Systems: Create orthogonal membrane fusion systems based on modified SEY1 proteins to study fusion mechanisms without interference from endogenous pathways.

  • Optogenetic SEY1 Control: Develop light-controlled SEY1 variants that can be activated or inactivated with subcellular precision.

Computational and Systems Approaches:

  • Molecular Dynamics Simulations: Perform all-atom simulations of SEY1-mediated membrane fusion to reveal energetics and kinetics of the process.

  • Network Analysis: Apply graph theory to analyze ER network topology changes in response to SEY1 manipulation.

  • Artificial Intelligence Applications: Use deep learning for automated analysis of ER morphology and dynamics in large imaging datasets.

Multi-omics Integration:

  • Spatial Transcriptomics: Map the spatial distribution of mRNAs encoding ER proteins relative to SEY1-enriched domains.

  • Proximity Proteomics: Apply BioID or APEX2 proximity labeling centered on SEY1 to map its protein interaction network under different conditions.

  • Lipidomics: Characterize lipid composition at SEY1-mediated fusion sites to understand lipid requirements and changes during fusion.

These emerging techniques will provide unprecedented insights into the molecular mechanisms, regulation, and physiological significance of SEY1-mediated membrane dynamics .

How might understanding SEY1 function contribute to broader insights in membrane biology and cell physiology?

Understanding SEY1 function has far-reaching implications for broader concepts in membrane biology and cell physiology:

Evolutionary Conservation of Membrane Fusion Mechanisms:
SEY1 represents an evolutionarily distinct solution to the same biological problem addressed by atlastins in mammals. Comparative studies between these systems can reveal fundamental principles of membrane fusion that transcend specific protein families. This evolutionary perspective helps identify both conserved mechanistic features and lineage-specific adaptations in membrane dynamics .

Principles of Biological Redundancy and Robustness:
The parallel operation of SEY1-mediated and SNARE-mediated ER fusion pathways provides an excellent model for studying how cells ensure robust essential functions through redundant mechanisms. This system can reveal principles of how parallel pathways are coordinated, how cells respond when one system fails, and how the relative contributions of parallel systems may shift under different conditions .

Organization of Membrane Contact Sites:
SEY1 functions at the tubular ER and interacts with tubule-shaping proteins like Rtn1p and Yop1p. This localization positions SEY1 at potential membrane contact sites between ER tubules and other organelles. Understanding how SEY1-mediated ER remodeling affects these contact sites could provide insights into inter-organelle communication and lipid transfer mechanisms.

Membrane-Cytoskeleton Interactions:
The ER network is physically linked to the cytoskeleton, and changes in ER morphology are coordinated with cytoskeletal dynamics. Studying how SEY1-mediated fusion events are coordinated with cytoskeletal changes can illuminate principles of organelle-cytoskeleton crosstalk.

Energy Homeostasis and Membrane Work:
As a GTPase, SEY1 converts chemical energy into mechanical work for membrane remodeling. This system provides a model for understanding how cells allocate energy resources for membrane dynamics and how these processes are regulated under different metabolic states.

Cellular Stress Responses:
ER morphology changes dramatically during various cellular stresses. Understanding how SEY1 function is modulated during stress responses could reveal principles of organelle plasticity and adaptation to changing cellular environments.

Implications for Disease Mechanisms:
Mutations in human atlastins cause hereditary spastic paraplegia, suggesting critical roles for ER-shaping proteins in neuronal function. Insights from SEY1 research in yeast can provide models for understanding how defects in membrane fusion proteins contribute to disease pathogenesis, potentially leading to therapeutic strategies.

By connecting SEY1 function to these broader themes, researchers can leverage this well-defined system to address fundamental questions in cell biology with implications beyond the specific protein and organism .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.