Recombinant Saccharomyces cerevisiae Protein SKG6 (SKG6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SKG6; YHR149C; Protein SKG6; Suppressor of lethality of KEX2-GAS1 double null mutant 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-734
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SKG6
Target Protein Sequence
MYHTHMHESLISVTSTVSVSDASYAYARLTRRDDSDSSSSSASSTKNSKSAECTGSKQQC QLPTDSSHSTSVTVGVAVAVPVGVIIIVLAVILCIVYRRSKKEAEEDNDPDFEGDSEFLP TMKDYSPGINHLYSSDSQQDFMEKTLQQPPSDPFVGSMHSSKYNVRSATPPAIGRSWYVD PFQLPQESNDSNSLRDFAMRVQEDGLGGYKVAAESRNASQTSLHPDNFSNCTPIRASSRF QESESFRSHGSPIHNNQLSRGSATEGANKQFTFPNEDNDSSSVSEEAEVLNESNESASND AFEFELDNSSEKTHERNLRFGKDDDNYELQDIREAEHMNDRSSSKSQDDDYYVSLLSPNE EEDIKRMKSIYQVYLDRAKTMKKEEDKADNANDISQEENRVDNIVQNPLPSIKINNNDNI DNNEVPEAKHLVKEALPLNNTNLAEYGPEMAQSQKQYPVQDTLTVNDTEAAPSNRIASSI YSEAIQPLNYQDQYQQQEQSPVYNGHTQYPGNGYSGNPQQQGYTAQFVQNPQWYGVPTPQ QQQHNHPQTLETIGELPTPAYLAQSASSHSLTSFKRPNKQQLLQLQTARLNGTALNPVDH PEMFYSPTNDAYYAPQQQGQYMKFNENGAVPSPYQLRQSVVMTNPSDLTAKPSYKPAGSF RSVSATNSRNNSLTTQNNIYLQQQQQQLYNSRVSGILEETDVVQPPSVGGILPHSGSQDD LRKQLGSSHNYTVN
Uniprot No.

Target Background

Function
Potentially involved in polarity establishment. Overexpression suppresses lethality in the KEX2-GAS1 double null mutant.
Gene References Into Functions
  1. Membrane protein exhibiting polarized intracellular localization. PMID: 16314687
  2. Suggests a negative regulatory role in cytokinesis. PMID: 16816427
Database Links

KEGG: sce:YHR149C

STRING: 4932.YHR149C

Protein Families
SKG6/TOS2 family
Subcellular Location
Membrane; Single-pass membrane protein. Note=Localizes primarily to the growing sites, such as an incipient bud site in the cells with emerging buds, a bud tip in small- or medium-budded cells, or a cell periphery in large-budded cells.

Q&A

What is SKG6 and what is its role in Saccharomyces cerevisiae?

SKG6 (Suppressor of lethality of KEX2-GAS1 double null mutant 6) is a membrane protein encoded by the SKG6 gene (YHR149C) in Saccharomyces cerevisiae. It was identified as one of 13 suppressor genes that can rescue the synthetic lethality caused by simultaneous deletion of KEX2 and GAS1 genes . The protein contains 734 amino acids and functions primarily in cellular pathways related to cell wall integrity. SKG6 exhibits polarized intracellular localization, suggesting a role in maintaining cell polarity and membrane organization. Its ability to suppress the lethal phenotype of kex2Δgas1Δ double mutants indicates its importance in compensatory mechanisms for cell wall maintenance when normal pathways are compromised.

What are the structural characteristics of the SKG6 protein?

The SKG6 protein (UniProt: P32900) consists of 734 amino acids with several notable structural features:

  • A transmembrane domain (approximately residues 67-87) that anchors the protein in the membrane

  • Multiple potential phosphorylation sites throughout the sequence

  • Several proline-rich regions that may facilitate protein-protein interactions

The protein appears to have both cytoplasmic and extracellular/lumenal domains based on its transmembrane topology, which is consistent with its role in cell wall-related processes.

How does SKG6 relate to the yeast secretory pathway?

While SKG6 itself is not a direct component of the core secretory machinery, its function intersects with the secretory pathway through its relationship with KEX2, a late Golgi processing endoprotease essential for proper protein maturation in the secretory pathway . The yeast secretory pathway involves the coordinated action of numerous proteins for translocation across the ER membrane, glycosylation, folding, quality control, and vesicle-mediated transport .

SKG6's ability to suppress defects caused by KEX2 deletion suggests it may provide alternative mechanisms for protein processing or trafficking when the canonical pathway is compromised. This connection is particularly relevant when considering that secretory pathway proteins often need to reach the cell surface or cell wall, where GAS1 (the other component of the synthetic lethal pair) functions as a β-1,3-glucanosyltransferase .

What methods are most effective for studying SKG6 localization in yeast cells?

To effectively study SKG6 localization, researchers should consider the following methodological approaches:

  • Fluorescent protein tagging:

    • Construct C-terminal or N-terminal GFP/mCherry fusions with SKG6, ensuring the tag doesn't disrupt the transmembrane domain

    • Verify functionality of the fusion protein by confirming its ability to suppress the kex2Δgas1Δ synthetic lethality

    • Examine localization by confocal microscopy in live cells under various conditions

  • Immunofluorescence microscopy:

    • Generate antibodies against purified recombinant SKG6 or use epitope-tagged versions

    • Perform cell fixation and permeabilization optimized for membrane proteins

    • Co-stain with markers for different cellular compartments (Golgi, plasma membrane, endosomes)

  • Subcellular fractionation:

    • Perform differential centrifugation to separate cellular components

    • Use density gradient centrifugation to isolate specific membrane fractions

    • Detect SKG6 by Western blotting in the separated fractions

    • Compare distribution with known markers of cellular compartments

The polarized intracellular localization reported for SKG6 suggests that time-lapse imaging during cell division or budding may be particularly informative for understanding its dynamic localization patterns.

How can recombinant SKG6 protein be efficiently expressed and purified?

Producing recombinant SKG6 requires careful optimization due to its membrane protein nature:

Expression Systems:

  • E. coli-based expression:

    • Use specialized strains (C41, C43) designed for membrane protein expression

    • Consider expressing soluble domains separately if full-length expression is problematic

    • Optimize codon usage for bacterial expression

    • Express with fusion tags (MBP, SUMO) to enhance solubility

  • Yeast expression systems:

    • Homologous expression in S. cerevisiae under control of strong, inducible promoters (GAL1, CUP1)

    • Heterologous expression in Pichia pastoris for higher yields

    • Include epitope tags (His6, FLAG) for purification

Purification Protocol:

  • Membrane isolation by ultracentrifugation

  • Solubilization with appropriate detergents (test panel: DDM, LMNG, CHAPS)

  • Affinity chromatography using tags (His6, GST)

  • Size exclusion chromatography for final purification

  • Detergent exchange if needed for specific applications

Quality Control Checkpoints:

  • SDS-PAGE and Western blotting to confirm size and purity

  • Mass spectrometry for identity confirmation

  • Circular dichroism to verify secondary structure integrity

  • Thermal shift assays to assess stability in different buffer conditions

For functional studies, consider reconstituting the purified protein into liposomes or nanodiscs to maintain native-like membrane environment.

What experimental approaches reveal how SKG6 suppresses kex2Δgas1Δ synthetic lethality?

To investigate the suppression mechanism of SKG6, researchers should employ a multi-faceted approach:

  • Genetic interaction mapping:

    • Perform synthetic genetic array (SGA) analysis with SKG6 overexpression against genome-wide deletion library

    • Identify pathways that become essential in the presence of overexpressed SKG6

    • Create double and triple mutants with other SKG genes to identify redundancy or synergy

  • Transcriptome and proteome analysis:

    • Compare RNA-seq profiles of:

      • Wild-type

      • kex2Δgas1Δ + vector control (under conditional GAS1 expression)

      • kex2Δgas1Δ + SKG6 overexpression

    • Perform quantitative proteomics to identify changes in protein abundance and post-translational modifications

  • Cell wall integrity assays:

    • Analyze susceptibility to cell wall-perturbing agents (Congo red, Calcofluor white)

    • Measure β-glucan and chitin content in the presence/absence of SKG6

    • Examine cell morphology and bud scar patterns by electron microscopy

  • Functional domain mapping:

    • Create truncation and point mutation variants of SKG6

    • Test each variant for suppression activity

    • Identify critical residues or domains required for function

Given that the GAS1 gene encodes a plasma membrane β-1,3-glucanosyltransferase and KEX2 encodes a late Golgi processing endoprotease , SKG6 likely functions in a pathway that can compensate for defects in cell wall biogenesis and/or protein processing when these genes are absent.

How does SKG6 contribute to cell wall integrity in S. cerevisiae?

While not directly mentioned in the search results as a canonical cell wall integrity protein, SKG6's suppression of kex2Δgas1Δ synthetic lethality strongly suggests its involvement in cell wall maintenance pathways. To investigate this function:

  • Cell wall compositional analysis:

    • Compare β-glucan, mannan, and chitin content in:

      • Wild-type cells

      • skg6Δ single mutants

      • skg6Δ in combination with mutations in known cell wall genes

  • Cell wall integrity (CWI) pathway activation:

    • Monitor phosphorylation of Slt2/Mpk1 (the terminal MAP kinase in the CWI pathway)

    • Measure transcriptional response of CWI target genes in SKG6 mutants

    • Test genetic interactions with components of the CWI signaling pathway

  • Response to cell wall stress:

    • Examine growth under cell wall-perturbing conditions:

      • Elevated temperature (37-39°C)

      • Osmotic stress (1M sorbitol)

      • Cell wall-degrading enzymes (zymolyase)

      • Antifungal drugs targeting cell wall (caspofungin)

  • Electron microscopy analysis:

    • Quantify cell wall thickness and ultrastructure in different genetic backgrounds

    • Examine localization of cell wall synthesis machinery

Since GAS1 is directly involved in β-1,3-glucan remodeling , SKG6 may participate in alternative glucan modification pathways or in the trafficking of other cell wall biosynthetic enzymes when normal processing by KEX2 is compromised.

How can SKG6 function be leveraged in recombinant protein production systems?

The connection between SKG6 and the secretory pathway through KEX2 suggests potential applications for enhancing recombinant protein production:

  • Optimizing secretion efficiency:

    • Test whether SKG6 overexpression improves secretion of heterologous proteins, particularly in strains with compromised KEX2 function

    • Create a panel of S. cerevisiae strains with varying SKG6 expression levels and assess their capacity for protein production

    • Evaluate secretion efficiency of model proteins (e.g., α-amylase, invertase) in these strains

  • Engineering improved expression hosts:

    • Develop S. cerevisiae strains with modified SKG6 expression for industrial applications

    • Consider co-expression of SKG6 with other SKG family members for synergistic effects

    • Create chimeric proteins combining functional domains of SKG6 with other secretory enhancers

  • Experimental design for optimization:

    Strain ConfigurationExpected Impact on SecretionRecommended Reporter Proteins
    Wild-typeBaseline controlα-amylase, invertase, albumin
    SKG6 overexpressionPotential enhancementComplex proteins with multiple domains
    SKG6 + KEX2 co-expressionSynergistic improvementProteins requiring KEX2 processing
    SKG6 + cell wall mutantsAltered secretion profileCell wall-associated enzymes
  • Application-specific considerations:

    • For therapeutic protein production, focus on glycosylation patterns in SKG6-modified strains

    • For industrial enzymes, assess activity and stability of proteins secreted from these strains

    • For structural biology applications, evaluate protein homogeneity and folding

The recent use of S. cerevisiae strain Y2805 for recombinant protein production could provide a foundation for testing SKG6 modifications in an industrially relevant context.

What are the most promising methods for studying SKG6 interactions with other cellular components?

To comprehensively map SKG6's interaction network:

  • Proximity-dependent labeling approaches:

    • BioID or TurboID fusion with SKG6 to identify proximal proteins in living cells

    • APEX2 fusion for spatially-restricted proteomic mapping

    • Compare interactomes in wild-type vs. kex2Δ or gas1Δ backgrounds

  • Affinity purification coupled with mass spectrometry:

    • Tandem affinity purification (TAP) with SKG6 as bait

    • Crosslinking mass spectrometry (XL-MS) to capture transient interactions

    • SILAC-based quantitative proteomics to compare interaction dynamics

  • Membrane-specific interaction methods:

    • Split-ubiquitin yeast two-hybrid screening for membrane protein interactions

    • Membrane yeast two-hybrid (MYTH) system

    • Bimolecular fluorescence complementation (BiFC) for in vivo validation

  • Functional genomics approaches:

    • Synthetic genetic array (SGA) analysis to map genetic interactions

    • Comparative analysis with interaction networks of other SKG family proteins

    • Integration with secretory pathway interaction datasets

Given SKG6's polarized intracellular localization , spatial proteomics approaches that preserve cellular compartmentalization would be particularly valuable for understanding context-specific interactions.

How conserved is SKG6 across different yeast species and what does this reveal about its function?

Although the search results don't directly address SKG6 conservation, we can formulate a research approach to investigate this question:

  • Comparative genomic analysis:

    • Perform sequence similarity searches across fungal genomes

    • Identify orthologs in other Saccharomyces species and more distant yeasts

    • Map conservation patterns to functional domains

  • Functional complementation studies:

    • Test whether SKG6 orthologs from other species can complement skg6Δ in S. cerevisiae

    • Express SKG6 in other yeasts with mutations in their endogenous orthologs

    • Compare the ability of different orthologs to suppress kex2Δgas1Δ synthetic lethality

  • Evolutionary rate analysis:

    • Calculate Ka/Ks ratios across different domains to identify regions under selection

    • Compare evolutionary trajectories of SKG6 with other genes involved in cell wall maintenance

    • Investigate co-evolution patterns with interacting proteins

This evolutionary perspective would be particularly valuable when considering that protein secretion pathways show significant functional differences between yeast species . For instance, the secretory pathway components in S. cerevisiae are often more redundant due to gene duplication compared to other yeasts like S. pombe , which might influence how SKG6 functions across different species.

What insights can be gained from studying SKG6 in industrial S. cerevisiae strains?

Industrial S. cerevisiae strains often have genomic and phenotypic differences from laboratory strains that could affect SKG6 function:

  • Comparative genomic analysis:

    • Sequence SKG6 loci from diverse industrial strains (wine, beer, bioethanol)

    • Identify polymorphisms that might affect protein function

    • Compare copy number variations that might alter expression levels

  • Expression profiling:

    • Analyze SKG6 expression levels across industrial strains under various growth conditions

    • Compare with laboratory strains to identify regulatory differences

    • Correlate expression patterns with industrial phenotypes

  • Industrial phenotype correlation:

    • Test whether SKG6 variants correlate with secretion capacity in industrial strains

    • Investigate potential links between SKG6 polymorphisms and stress tolerance

    • Examine cell wall characteristics in strains with different SKG6 alleles

  • Application-specific research:

    • For protein production strains like Y2805 , investigate whether SKG6 modifications can enhance production capacity

    • For fermentation strains, test if SKG6 variations affect cell surface properties relevant to fermentation performance

Industrial strains often face different selective pressures compared to laboratory strains, particularly regarding stress tolerance and protein secretion capabilities, making them valuable systems for studying SKG6 function in diverse genetic backgrounds.

What are the most promising unresolved questions about SKG6 function?

Several key questions remain open for investigation:

  • Molecular mechanism of synthetic lethality suppression:

    • How does SKG6 compensate for the simultaneous loss of KEX2 and GAS1?

    • Does it act directly on cell wall synthesis or indirectly through signaling pathways?

    • What specific cellular processes are rescued by SKG6 overexpression?

  • Regulatory network:

    • How is SKG6 expression regulated under normal and stress conditions?

    • Does it respond to cell wall integrity pathway signaling?

    • What transcription factors control its expression?

  • Protein interactions and complexes:

    • Does SKG6 form homo-oligomers or hetero-oligomers?

    • What are its key binding partners in different cellular compartments?

    • How does its polarized localization contribute to function?

  • Post-translational modifications:

    • What modifications (phosphorylation, glycosylation, etc.) occur on SKG6?

    • How do these modifications regulate its activity or localization?

    • Which kinases or other modifying enzymes target SKG6?

Addressing these questions would significantly advance our understanding of SKG6's role in yeast cell biology and potentially reveal new aspects of secretory pathway regulation and cell wall maintenance.

How might CRISPR-Cas9 genome editing advance SKG6 research?

CRISPR-Cas9 technology offers powerful approaches for studying SKG6:

  • Precise genetic manipulation:

    • Create clean deletions, point mutations, and domain swaps at the endogenous locus

    • Engineer conditional alleles using degron tags

    • Generate libraries of SKG6 variants with systematic mutations

  • Regulatory studies:

    • Edit promoter elements to understand transcriptional regulation

    • Create reporter fusions at the endogenous locus

    • Engineer inducible or repressible versions of SKG6

  • High-throughput functional screens:

    • Perform CRISPR activation (CRISPRa) or interference (CRISPRi) to modulate SKG6 expression

    • Conduct genome-wide screens for genes that interact with SKG6

    • Create SKG6 variant libraries for structure-function analysis

  • Multi-gene studies:

    • Simultaneously edit SKG6 and other SKG family members

    • Create multiple mutations in related pathways

    • Engineer strains with optimized expression of entire protein complexes

CRISPR-based approaches would be particularly valuable for studying SKG6 in its native genomic context, avoiding artifacts that can arise from plasmid-based overexpression systems traditionally used in suppressor screens.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.