Recombinant Saccharomyces cerevisiae Protein SLM4 (SLM4)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
SLM4; EGO3; GSE1; YBR077C; YBR0723; Protein SLM4; EGO complex subunit 3; GSE complex subunit 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-162
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SLM4
Target Protein Sequence
MVMLHSKNVKGFLENTLKPYDLHSVDFKTSSLQSSMIITATNGGILSYATSNNDVPKNSI
NEINSVNNLKMMSLLIKDKWSEDENDTEEQHSNSCYPVEIDSFKTKIYTYEMEDLHTCVA
QIPNSDLLLLFIAEGSFPYGLLVIKIERAMRELTDLFGYKLG
Uniprot No.
Target Background
Function
SLM4 is a component of the GSE complex, a GTPase complex crucial for intracellular sorting of GAP1 from endosomes. It is also a component of the EGO complex, involved in regulating microautophagy.
Gene References Into Functions
- Ego2 interacts with Ego1 and Ego3 to form a stable complex; all three components are essential for vacuolar recruitment of Gtr1-Gtr2 GTPases and the activation of TORC1 signaling in response to amino acids. PMID: 26206314
- The unique dimer conformation of Ego3 is critical for the integrity and function of the EGO complex in Saccharomyces cerevisiae. PMID: 23123112
- Gtr2 and the EGO complex (Ego1 and Ego3) orchestrate microautophagy in yeast. PMID: 15989961
Database Links
KEGG: sce:YBR077C
STRING: 4932.YBR077C
Subcellular Location
Vacuole membrane; Single-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
