Recombinant Saccharomyces cerevisiae Protein SLM6 (SLM6)

What is SLM6 and what is its functional significance in Saccharomyces cerevisiae?

SLM6 (Synthetic Lethal with MSS4 protein 6) is a protein encoded by the YBR266C gene in Saccharomyces cerevisiae. It exhibits synthetic genetic interactions with MSS4, which encodes an essential phosphatidylinositol-4-phosphate (PI4P) kinase that produces phosphatidylinositol-4,5-bisphosphate (PI(4,5)P2) . SLM6 is involved in membrane trafficking processes and stress responses, particularly under challenging environmental conditions.

The functional characterization data from growth assays shows the following phenotypic measurements:

These measurements indicate SLM6's involvement in growth under various pressure and temperature conditions .

What expression systems are most effective for producing recombinant SLM6 in yeast?

For effective recombinant SLM6 production in S. cerevisiae, researchers should consider:

• Promoter selection: Strong constitutive promoters like TEF1 or TPI1 are recommended for consistent expression. The TEF1 promoter has demonstrated functionality across various yeast species and maintains high expression levels in both glucose-rich and glucose-limited conditions .

• Expression vectors: Three main types are available:

  • Integration plasmids (YIp) - most stable but lower copy number

  • Episomal plasmids (YEp) - higher copy number (5-30 copies) but less stable

  • Centromeric plasmids (YCp) - low copy number (1-2 copies) with moderate stability

• Marker systems: POT1-based expression systems have demonstrated superior plasmid stability, even when strains are cultivated in rich medium, generating higher cell numbers and protein production compared to URA3-based systems .

Methodological approach: Clone the SLM6 gene using PCR amplification with appropriate restriction sites, ligate into a chosen expression vector (preferably with the TEF1 promoter), and transform into S. cerevisiae. The expression can be validated using Western blot with anti-His tag antibodies if a His-tag was incorporated into the construct .

How can researchers validate the expression and purification of recombinant SLM6?

A methodological workflow for validating recombinant SLM6 expression includes:

• PCR verification: Following transformation, perform colony PCR to verify the presence of the SLM6 gene in transformants using gene-specific primers.

• Protein expression analysis:

  • Western blotting using commercially available SLM6-specific antibodies (e.g., CSB-PA336440XA01SVG) or anti-His antibodies if the construct includes a His-tag

  • SDS-PAGE analysis to confirm protein size (SLM6 is approximately 150 amino acids)

• Purification validation:

  • For His-tagged constructs, use immobilized metal affinity chromatography (IMAC)

  • Assess purity using SDS-PAGE and protein concentration using Bradford or BCA assays

  • Confirm identity using mass spectrometry

• Activity assessment:

  • Evaluate functionality through complementation assays in SLM6-deficient yeast strains

  • Monitor PI(4,5)P2 levels in recombinant vs. control cells to assess functional interaction with MSS4

Storage recommendation: Store purified SLM6 in Tris-based buffer with 50% glycerol at -20°C for short-term or -80°C for long-term storage to maintain stability .

What genetic approaches can be employed to study SLM6 function and its interaction with MSS4?

Advanced genetic strategies for investigating SLM6 function include:

• Synthetic genetic array (SGA) analysis:

  • Create a SLM6 deletion strain and cross it with a genome-wide deletion collection

  • Score genetic interactions to identify functional relationships

  • Particularly useful for identifying additional genes that exhibit synthetic lethality with MSS4

• Site-directed mutagenesis:

  • Introduce specific mutations in SLM6 to identify critical residues for function

  • Transform mutant constructs into SLM6 deletion strains and assess complementation

• Suppressor screens:

  • Isolate suppressors of synthetic lethality between SLM6 and MSS4 to identify pathway components

  • Use high-throughput sequencing to identify suppressors

• CRISPR-Cas9 genome editing:

  • Generate precise modifications to the SLM6 locus

  • Create conditional alleles using promoter replacements

  • Introduce epitope tags for protein localization and interaction studies

• Protein-protein interaction studies:

  • Use yeast two-hybrid, bimolecular fluorescence complementation (BiFC), or co-immunoprecipitation to map interactions

  • Focus on identifying physical interactions with MSS4 and other membrane trafficking components

When designing these experiments, it's crucial to include appropriate controls and validate findings through multiple complementary approaches .

How does SLM6 deletion affect yeast cell physiology under various stress conditions?

SLM6 deletion significantly impacts yeast resilience to environmental stresses, with distinct physiological responses:

• High hydrostatic pressure response:

  • SLM6 deletion strains show reduced growth at 25 MPa (OD600 of 1.1 ± 0.3) compared to wild-type strains (OD600 of 1.6 ± 0.3)

  • The introduction of nutrient prototrophies partially rescues this growth defect (increasing OD600 to 1.5 ± 0.3)

• Low temperature stress:

  • SLM6 deletion strains exhibit impaired growth at 15°C (OD600 of 0.8 ± 0.2) compared to wild-type at standard conditions

  • This phenotype is not significantly rescued by nutrient supplementation

• Membrane integrity:

  • The impaired growth under pressure suggests SLM6's involvement in maintaining membrane integrity and/or function

  • This aligns with its genetic interaction with MSS4, which produces PI(4,5)P2, a key regulator of membrane dynamics

• Nutrient uptake:

  • The partial rescue of growth defects through nutrient supplementation suggests SLM6 may play a role in nutrient transport or uptake mechanisms

  • This is consistent with the observation that multiple deletion mutants showing pressure sensitivity are rescued by introduction of four plasmids (LEU2, HIS3, LYS2, and URA3)

Methodology for studying these effects: Compare growth rates, membrane integrity (using fluorescent dyes like FM4-64), and nutrient uptake assays between wild-type and SLM6 deletion strains under varying pressure, temperature, and nutrient conditions.

What are the methodological considerations for analyzing SLM6's role in membrane trafficking pathways?

When investigating SLM6's function in membrane trafficking, researchers should consider these methodological approaches:

• Fluorescence microscopy for protein localization:

  • Create GFP or mRFP fusions with SLM6 to track its subcellular localization

  • Use established markers for various compartments (ER, Golgi, endosomes, plasma membrane)

  • Conduct time-lapse imaging to observe dynamic changes during stress conditions

  • Example approach: Similar to how Sec6-4p localization was studied with yEGfp3p tagging

• Lipidomic analysis:

  • Quantify phosphoinositide levels, particularly PI(4,5)P2, using mass spectrometry

  • Compare lipid profiles between wild-type and SLM6 deletion strains

  • Assess changes in lipid composition under stress conditions

• Vesicle isolation and characterization:

  • Isolate secretory vesicles using differential centrifugation

  • Characterize protein and lipid composition of vesicles

  • Compare vesicle populations between wild-type and mutant strains

  • Consider approaches similar to those used for sec6-4 vesicle isolation and characterization

• Protein trafficking assays:

  • Monitor transport of model cargo proteins in SLM6 deletion strains

  • Use pulse-chase experiments to track protein movement through the secretory pathway

  • Employ temperature shifts to synchronize trafficking events

• Genetic interactions mapping:

  • Construct double mutants with genes involved in different trafficking steps

  • Assess synthetic genetic interactions to place SLM6 in specific trafficking pathways

  • Focus particularly on interactions with components of the exocyst complex, given SLM6's relationship with MSS4

Critical controls: Include temperature-sensitive trafficking mutants (e.g., sec6-4) as positive controls, and unrelated gene deletions as negative controls to ensure specificity of observed phenotypes.

What challenges arise in obtaining functional recombinant SLM6, and how can they be addressed?

Production of functional recombinant SLM6 presents several specific challenges:

• Protein folding and solubility issues:

  • Challenge: As a membrane-associated protein working with PI(4,5)P2, SLM6 may have hydrophobic regions causing folding issues

  • Solution: Optimize expression temperature (lower to 16-20°C), use solubility-enhancing tags (SUMO, MBP), or coexpress with yeast chaperones like Kar2p/BiP

• Post-translational modification requirements:

  • Challenge: SLM6 may require specific phosphorylation or lipid modifications for function

  • Solution: Use eukaryotic expression systems that preserve these modifications; avoid prokaryotic systems for functional studies

• Expression level optimization:

  • Challenge: Overexpression may lead to aggregation or toxicity

  • Solution: Use regulated promoters (e.g., GAL1 instead of constitutive TEF1) to fine-tune expression levels

• Protein purification complexities:

  • Challenge: Maintaining stability during extraction and purification

  • Solution: Use gentle detergents (DDM, LMNG) for extraction; include phospholipids or PI(4,5)P2 in purification buffers; consider native purification approaches

• Functional validation methods:

  • Challenge: Developing assays to confirm recombinant protein functionality

  • Solution: Establish complementation assays in SLM6-deficient strains; develop in vitro assays measuring PI(4,5)P2 binding or related biochemical activities

Experimental approach comparison:

How does the interaction between SLM6 and the phosphoinositide pathway affect membrane dynamics under stress conditions?

The SLM6-phosphoinositide pathway interaction has significant implications for membrane dynamics during stress:

• Molecular mechanism of interaction:

  • SLM6 exhibits synthetic genetic interactions with MSS4, which produces PI(4,5)P2

  • This suggests SLM6 functions in a parallel or compensatory pathway to MSS4

  • Under stress conditions, these pathways likely converge to maintain membrane integrity

• Membrane reorganization during stress response:

  • High pressure and low temperature cause membrane rigidification

  • PI(4,5)P2 acts as a signaling lipid and structural component affecting membrane curvature

  • SLM6 may help regulate PI(4,5)P2 distribution or downstream effects during stress

• Nutrient transport modulation:

  • PI(4,5)P2 regulates endocytosis and exocytosis of nutrient transporters

  • The observed rescue of SLM6 deletion phenotypes by nutrient supplementation suggests a role in transporter regulation

  • SLM6 might influence the trafficking, stability, or activity of nutrient transporters in a PI(4,5)P2-dependent manner

• Cytoskeletal interactions:

  • PI(4,5)P2 mediates interactions between membrane and actin cytoskeleton

  • SLM6 could participate in cytoskeletal reorganization during stress adaptation

  • This would explain the growth defects under pressure and temperature stress

Experimental approach to investigate this interaction: Combine live-cell imaging of fluorescently tagged SLM6 with PI(4,5)P2 biosensors (e.g., PH-domain probes) to visualize dynamic changes during stress application. Monitor redistribution of both SLM6 and PI(4,5)P2 under various stressors, including temperature shifts and osmotic challenges.

What structural and biochemical properties of SLM6 contribute to its function in membrane trafficking?

Although detailed structural information for SLM6 is limited, several properties can be inferred based on available data and structural prediction methods:

• Amino acid sequence analysis:

  • SLM6 consists of 150 amino acids with the sequence: MCSRFSSTSLKCLLCSQNRHCSSGISTLLRTFSCITLSAISSSVNCSGSSFLGSSFSLFS SFSCKESLLRSGVFPSWLFCMFSSILALAISNSFFFFSSNACFSLLFNSFLVTGFSFSAD LLVLAAAADTLESNVSNDIGGNCATRLFKL

  • The sequence contains multiple cysteine residues (C), suggesting potential for disulfide bond formation or metal coordination

  • Several hydrophobic stretches indicate possible membrane-interacting regions

• Predicted structural elements:

  • Secondary structure prediction suggests a mix of α-helical and β-sheet regions

  • The hydrophobic regions may form transmembrane domains or membrane-association motifs

  • Multiple serine (S) and threonine (T) residues provide potential phosphorylation sites

• Functional domains:

  • PI(4,5)P2 binding motifs may be present, similar to other proteins interacting with phosphoinositides

  • Potential protein-protein interaction domains for association with trafficking machinery

  • Possible stress-responsive regulatory elements

• Post-translational modifications:

  • Phosphorylation sites may regulate SLM6 activity or localization

  • Lipid modifications could enhance membrane association

Methodological approaches to characterize these properties:

• Site-directed mutagenesis: Systematically mutate key residues (cysteines, serines/threonines, hydrophobic patches) and assess functional consequences

• Domain mapping: Create truncated versions of SLM6 to identify minimal functional regions

• Phosphoinositide binding assays: Use protein-lipid overlay assays or liposome flotation experiments to characterize lipid binding preferences

• Structural biology approaches: Express and purify domains for crystallography or NMR studies; alternatively, use cryo-EM for full-length protein

• Phosphoproteomic analysis: Identify phosphorylation sites under normal and stress conditions

These analyses would provide crucial insights into how SLM6 structurally and biochemically participates in membrane trafficking pathways, particularly under stress conditions.