Recombinant Saccharomyces cerevisiae Protein SNA3 (SNA3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to customer specifications.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
SNA3; YJL151C; J0630; Protein SNA3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-133
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SNA3
Target Protein Sequence
MDRDHINDHDHRMSYSINKDDLLLMVLAVFIPPVAVWKRKGMFNRDTLLNLLLFLLLFFP AIIHACYVVYETSSERSYDLSRRHATAPAVDRDLEAHPAEESQAQPPAYDEDDEAGADVP LMDNKQQLSSGRT
Uniprot No.

Target Background

Gene References Into Functions
  1. Sna3 competes with Bul1 for the Rsp5 WW domain, influencing the degradation of the tryptophan permease Tat2. [PMID: 19944104]
  2. Studies reveal key determinants impacting Sna3 multivesicular bodies sorting, including unexpected roles for Rsp5. [PMID: 17182849]
  3. Sna3 bypasses Ub-mediated recognition by directly interacting with Rsp5, an E3 Ub ligase that catalyzes the monoubiquitination of multivesicular bodies vesicle cargoes. [PMID: 17182850]
  4. Sna3p sorting relies on a direct interaction between a PPAY motif in its C-terminal cytosolic tail and the WW domains of Rsp5p. [PMID: 17332499]
  5. Sna3p undergoes Rsp5-dependent polyubiquitylation with K63-linked ubiquitin chains during its sorting to the endosomal pathway. [PMID: 17645729]
Database Links

KEGG: sce:YJL151C

STRING: 4932.YJL151C

Protein Families
UPF0057 (PMP3) family
Subcellular Location
Membrane; Multi-pass membrane protein. Late endosome membrane; Multi-pass membrane protein. Vacuole lumen. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Note=Sorted via late endosomes to the vacuolar lumen in a ubiquitin-independent manner.

Q&A

How does the structure of SNA3 relate to its functional properties?

SNA3 contains several key structural elements that are critical for its function and trafficking. First, it possesses a PPAY motif that mediates interaction with the WW domains of Rsp5 ubiquitin ligase . This interaction is essential not only for SNA3's own ubiquitination but also for its sorting regardless of ubiquitination status. Second, SNA3 contains a tyrosine-containing region that impacts its MVB sorting . Third, SNA3 has lysine residues that can be ubiquitinated, with lysine 125 specifically identified as a ubiquitination site . The amino-terminal domain of SNA3, particularly the first 20 amino acids containing an MSYS region, also contributes to MVB sorting through mechanisms distinct from the PPAY motif . These structural elements create a system of partially redundant signals that collectively determine SNA3 trafficking and function in the cell.

What cellular pathways is SNA3 involved in?

SNA3 is primarily involved in the MVB (multivesicular body) pathway, which is responsible for sorting membrane proteins destined for degradation in the vacuole (the yeast equivalent of the lysosome). SNA3 requires ESCRT (Endosomal Sorting Complex Required for Transport) function to enter the MVB pathway . Additionally, SNA3 functions in the Rsp5-mediated ubiquitination pathway, where it can serve as both a substrate and an adaptor protein that facilitates ubiquitination of other membrane proteins . Research has demonstrated that SNA3 interacts with various membrane proteins, including the methionine transporter Mup1, suggesting a role in nutrient transporter regulation . This positions SNA3 at the intersection of protein trafficking, ubiquitin-mediated degradation, and potentially nutrient homeostasis pathways in yeast cells.

How does ubiquitination affect SNA3 sorting and function?

Ubiquitination plays a complex role in SNA3 sorting and function. Initially thought to be ubiquitin-independent, research now shows that SNA3 trafficking depends significantly on Rsp5-mediated ubiquitination . SNA3 undergoes Ub-dependent MVB sorting through two mechanisms: either by becoming ubiquitinated itself (primarily at lysine 125) or by associating with other ubiquitinated membrane protein substrates . When deubiquitinating enzyme domains are attached to ESCRT machinery or Rsp5, they block SNA3-GFP MVB sorting, supporting ubiquitin's essential role in this process .

Interestingly, while ubiquitination potentiates SNA3 MVB sorting, it is not absolutely essential. SNA3 appears to have a partially redundant sorting system where non-ubiquitin signals (like the PPAY motif and tyrosine-containing regions) can still facilitate trafficking even when ubiquitination is compromised . This creates a sophisticated regulatory system where ubiquitination enhances efficiency but alternative mechanisms provide backup sorting capabilities, ensuring robust protein trafficking under varying cellular conditions.

What is the relationship between SNA3 and the Rsp5 ubiquitin ligase?

The relationship between SNA3 and Rsp5 ubiquitin ligase is multifaceted and bidirectional. SNA3 contains a PPAY motif that directly interacts with the WW domains of Rsp5, making SNA3 a substrate for Rsp5-mediated ubiquitination . This interaction is essential for SNA3's proper trafficking to the MVB and subsequently to the vacuole. Mutations in the PPAY motif significantly impair this process, even when other sorting signals remain intact .

Beyond being a substrate, SNA3 functions as an adaptor protein for Rsp5 . In this capacity, SNA3 recruits Rsp5 to other membrane proteins, such as the methionine transporter Mup1, facilitating their ubiquitination and subsequent degradation. This adaptor function places SNA3 among several recently characterized Rsp5 adaptors that contain PY motifs allowing them to associate with both Rsp5 and various substrate proteins . The dual role of SNA3 as both substrate and adaptor highlights its importance in the ubiquitin-mediated regulation of membrane protein trafficking and turnover in yeast cells.

How do the multiple sorting signals in SNA3 coordinate to determine its trafficking fate?

SNA3 trafficking is regulated by multiple partially redundant sorting signals that work in concert to determine its ultimate fate. Three primary determinants have been identified: lysine ubiquitination, a tyrosine-containing region, and a PPAY motif . These signals appear to function through distinct mechanisms but coordinate to ensure proper MVB sorting.

This multilayered system creates a sophisticated regulatory network where the absence of one signal can be compensated for by others, ensuring robust trafficking even under conditions where one pathway might be compromised. The relative contribution of each signal likely varies depending on cellular conditions, providing flexibility in protein sorting regulation.

What methodologies are most effective for studying the interaction between SNA3 and its cargo proteins?

For investigating interactions between SNA3 and its cargo proteins, a multi-method approach yields the most comprehensive results. Biomolecular complementation assays, particularly those designed for membrane proteins such as the DHFR (dihydrofolate reductase) complementation technique, have proven especially valuable . This approach successfully identified interactions between SNA3 and various membrane proteins, including the methionine transporter Mup1 .

Co-immunoprecipitation studies in strains lacking endosomal components (such as pep12Δ mutants) offer another powerful approach, as these mutations stabilize ubiquitin-modified MVB cargoes and enhance detection of transient interactions . When combined with epitope-tagged variants and Western blotting, this technique can reveal both direct binding and ubiquitination patterns. For example, immunoprecipitations with anti-SNA3 polyclonal antibody followed by anti-GFP and anti-HA Western blotting have been effective in characterizing SNA3 ubiquitination states .

Fluorescence microscopy using GFP-tagged fusion proteins provides crucial spatial information about trafficking patterns. Creating chimeric proteins where domains of SNA3 are fused to other proteins (like DPAP B) can isolate sorting determinants and identify minimum functional regions . For studying the dynamics of these interactions, inducible expression systems using methionine or other nutrients to trigger transporter internalization have proven valuable in characterizing SNA3's adaptor functions .

How can contradictory data regarding SNA3 ubiquitination be resolved?

The contradictory data regarding SNA3 ubiquitination reflects the complexity of protein modification and sorting in yeast. Initially characterized as a ubiquitin-independent cargo, later studies have clearly demonstrated that SNA3 is ubiquitinated and that this modification impacts its trafficking . To resolve these contradictions, researchers should consider several methodological approaches.

First, utilizing strains with stabilized ubiquitination (such as pep12Δ mutants) enhances detection of ubiquitinated species that might be rapidly degraded in wild-type cells . Second, employing multiple tagging strategies is crucial, as some tags may interfere with ubiquitination sites or sorting signals. For instance, positioning GFP at either the N-terminus or C-terminus of SNA3 revealed different ubiquitination patterns, indicating the importance of amino-terminal modification .

Third, creating a series of lysine mutants (beyond just the identified K125 site) is essential, as residual ubiquitination observed in KallR mutants suggests either non-lysine ubiquitination or ubiquitination of associated proteins . Fourth, using deubiquitinating enzyme domains (DUbs) attached to various components of the sorting machinery provides a powerful approach to dissect the functional requirement for ubiquitination without directly altering SNA3 itself .

Finally, researchers should consider that SNA3 may be sorted through multiple partially redundant mechanisms, where ubiquitination enhances efficiency but is not absolutely required in all contexts. This explains why different experimental conditions might yield apparently contradictory results regarding ubiquitin dependence.

What are the implications of SNA3's role as an adaptor protein for understanding membrane protein turnover?

The discovery that SNA3 functions as an adaptor protein for Rsp5 has significant implications for understanding the broader regulation of membrane protein turnover in eukaryotic cells. This finding places SNA3 in a growing network of substrate-specific adaptors that help determine the specificity and timing of protein degradation .

The SNA3-Rsp5 interaction represents an elegant regulatory mechanism where a protein that is itself subject to ubiquitination-dependent sorting can simultaneously facilitate the modification of other substrates. This creates potential for feedback loops and regulatory cascades that fine-tune membrane protein composition in response to changing environmental conditions. For instance, SNA3's role in Mup1 degradation suggests coordination between different nutrient sensing pathways .

Furthermore, SNA3's multiple sorting signals provide insights into how cells ensure robust trafficking when primary ubiquitination signals are compromised. This redundancy may represent an evolutionary adaptation to maintain essential protein turnover processes even when the ubiquitination machinery is overwhelmed or impaired. The identification of similar mechanisms in higher eukaryotes could reveal conserved principles of membrane protein homeostasis relevant to human disease states where protein trafficking is dysregulated.

From a methodological perspective, SNA3's adaptor function suggests it could potentially be engineered as a tool for selectively targeting proteins for degradation in synthetic biology applications. Understanding the determinants of SNA3-substrate specificity could enable the design of chimeric adaptors with novel targeting capabilities.

What expression systems are most effective for producing recombinant SNA3 protein?

For producing recombinant SNA3 protein, several expression systems have shown effectiveness, each with distinct advantages depending on the experimental goals. Yeast-based expression systems, particularly those using Saccharomyces cerevisiae itself, offer the most native post-translational modifications and proper folding environment for SNA3 . Eukaryotic expression in S. cerevisiae can be achieved using vectors with appropriate selection markers addressing the auxotrophic requirements of the host strain .

For higher yields and easier purification, adding affinity tags such as 6xHis-tags at the N-terminus facilitates isolation through metal affinity chromatography while maintaining protein functionality . When expressing SNA3 in yeast, achieving up to 90% purity is possible using appropriate SDS-PAGE techniques for analysis . The predicted molecular weight of tagged SNA3 should be calculated based on its amino acid sequence, but researchers should anticipate slightly higher observed molecular masses during SDS-PAGE analysis due to post-translational modifications like glycosylation .

For studies requiring domains rather than full-length protein, expressing specific regions (such as the PPAY-containing segment or the tyrosine-containing region) can be valuable for interaction studies . When domain-specific expression is needed, bacterial systems like E. coli may offer simpler production for non-glycosylated fragments, though proper folding must be verified . For all expression systems, optimizing codon usage for the host organism significantly improves yield and quality of recombinant SNA3.

What purification strategies yield the highest purity and activity for recombinant SNA3?

Purifying recombinant SNA3 to high levels of purity while maintaining its activity requires a carefully designed strategy that accounts for its membrane protein nature and post-translational modifications. For His-tagged SNA3 variants, immobilized metal affinity chromatography (IMAC) using Ni-NTA or cobalt resins provides an effective first purification step . This approach can achieve approximately 90% purity as determined by SDS-PAGE analysis .

For applications requiring higher purity, additional chromatography steps are recommended. Size exclusion chromatography (SEC) helps separate SNA3 from aggregates and differently sized contaminants while maintaining the protein in a native-like environment. Ion exchange chromatography can further refine purity based on SNA3's charge properties, though buffer conditions must be carefully optimized to prevent denaturation of this membrane protein.

Throughout purification, detergent selection is critical for maintaining SNA3 in a soluble, active state. Mild non-ionic detergents like DDM (n-Dodecyl β-D-maltoside) or LMNG (lauryl maltose neopentyl glycol) generally preserve membrane protein function better than harsher ionic detergents. Activity assays based on SNA3's ability to interact with Rsp5 or facilitate ubiquitination of cargo proteins can verify that purified protein retains its functional properties .

For projects requiring native post-translational modifications, direct purification from S. cerevisiae yields the most biologically relevant protein form, though at lower yields than heterologous systems . Table 1 summarizes key purification parameters and their impact on SNA3 quality:

Purification ParameterRecommended ApproachImpact on SNA3 Quality
Initial CaptureNi-NTA IMAC for His-tagged variantsAchieves ~90% purity with minimal steps
Detergent SelectionDDM or LMNGMaintains membrane protein folding and activity
Secondary PurificationSize exclusion chromatographyRemoves aggregates and improves homogeneity
Buffer Composition20-50 mM phosphate or Tris, pH 7.5, 150-300 mM NaClStabilizes protein and prevents aggregation
Storage Conditions-80°C in buffer with 10% glycerolPreserves activity during freeze-thaw cycles

What are the most reliable methods for studying SNA3 trafficking in live cells?

Time-course experiments following induction of protein expression or application of specific stressors provide valuable insights into trafficking dynamics. For example, monitoring GFP-SNA3 localization after methionine addition reveals coordination between SNA3 and methionine transporter (Mup1) trafficking . For multi-color imaging, combining GFP-tagged SNA3 with RFP-tagged markers for specific compartments (vacuole, endosomes, MVBs) enables precise tracking of protein movement through the endomembrane system.

Genetic approaches using strains with mutations in trafficking machinery components (ESCRT mutants, Rsp5 mutants, deubiquitinating enzyme overexpression) reveal the requirements for specific trafficking steps . Creating chimeric proteins where domains of SNA3 are fused to normally vacuolar membrane-localized proteins like DPAP B offers a powerful approach to identify minimum sorting determinants .

For quantitative analysis, flow cytometry of GFP-tagged SNA3 in various genetic backgrounds can provide population-level data on trafficking efficiency. Combining these approaches with biochemical techniques like cell fractionation and immunoblotting for ubiquitinated species creates a comprehensive picture of SNA3 trafficking dynamics in response to various cellular conditions and genetic perturbations.

How should researchers interpret differences in SNA3 trafficking patterns across different experimental conditions?

When interpreting differences in SNA3 trafficking patterns across experimental conditions, researchers should consider multiple complementary factors. First, examine the temporal dimension of trafficking. Early endosomal localization followed by MVB/vacuolar localization represents normal trafficking progression, while persistent plasma membrane or endosomal localization suggests trafficking defects . Different rates of trafficking completion may indicate modulation rather than complete blockage of the pathway.

Second, quantify the distribution pattern. The proportion of SNA3 in different compartments (plasma membrane, endosomes, MVBs, vacuole lumen, vacuole membrane) provides insights into which specific trafficking step might be affected. For example, accumulation at the MVB without delivery to the vacuole suggests defects in MVB-vacuole fusion rather than initial internalization .

Third, assess ubiquitination status in parallel with localization. Changes in ubiquitination pattern that correlate with altered trafficking help establish causative relationships between these processes . Note that residual trafficking despite abolished ubiquitination may indicate activation of alternative, redundant sorting mechanisms .

Fourth, consider genetic interactions. Effects that are synthetic or suppressive when combinations of mutations are introduced reveal pathway relationships. For instance, differential effects of SNA3 PPAY mutations in wild-type versus ubiquitination-deficient backgrounds highlight the dual roles of this motif .

Finally, compare SNA3 trafficking with that of other cargo proteins under identical conditions. Cargo-specific effects suggest adaptor functions, while global trafficking defects indicate disruption of core machinery. This comprehensive analytical approach enables reliable interpretation of complex trafficking phenotypes.

What statistical approaches are most appropriate for analyzing SNA3 ubiquitination data?

Analyzing SNA3 ubiquitination data requires statistical approaches that can accommodate the complexity of post-translational modification patterns. For quantifying ubiquitination levels from immunoblots, densitometry analysis should measure both unmodified and all higher molecular weight species corresponding to mono- and poly-ubiquitinated forms . Normalization to total SNA3 protein levels is essential for meaningful comparisons across conditions.

When analyzing the effects of mutations or treatments on ubiquitination patterns, repeated measures ANOVA is appropriate for evaluating changes across multiple experimental replicates while accounting for batch-to-batch variation. Post-hoc Tukey's HSD or Bonferroni-corrected t-tests can identify specific significant differences between conditions. For all statistical analyses, a minimum of three biological replicates is recommended to ensure reliability.

For complex datasets comparing multiple SNA3 variants across different genetic backgrounds, multivariate approaches such as principal component analysis (PCA) can reveal patterns that might not be apparent from pairwise comparisons. When correlating ubiquitination levels with trafficking outcomes, regression analysis with appropriate transforms for non-linear relationships provides quantitative insights into how these processes are linked.

Additionally, Bayesian statistical approaches can be valuable when incorporating prior knowledge about ubiquitination mechanisms into the analysis of new experimental data. This is particularly useful when dealing with the partially redundant nature of SNA3 sorting signals, where effects may be probabilistic rather than deterministic. Regardless of the specific statistical approach, researchers should clearly report both the magnitude of observed effects (effect sizes) and their statistical significance to enable proper interpretation.

How can researchers distinguish between direct and indirect effects when studying SNA3 interactions with cargo proteins?

Distinguishing between direct and indirect effects in SNA3-cargo protein interactions requires a multi-faceted experimental approach. In vitro binding assays using purified components provide the most direct evidence of physical interaction. Surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) with purified SNA3 and potential cargo proteins can determine binding affinities and kinetics without cellular confounding factors .

For in vivo studies, proximity-based approaches like DHFR complementation assays have proven valuable for detecting membrane protein interactions . These methods can identify interactions that might be missed by co-immunoprecipitation due to their transient nature or dependence on membrane contexts. Cross-linking before immunoprecipitation can stabilize transient interactions, though this approach requires careful controls to distinguish specific from non-specific associations.

Domain mapping through deletion and point mutations in both SNA3 and cargo proteins helps identify specific interaction interfaces. If mutation of the SNA3 PPAY motif abolishes both Rsp5 interaction and cargo ubiquitination without affecting direct cargo binding, this suggests an indirect effect mediated by Rsp5 recruitment rather than direct cargo recognition .

Temporal analysis is also crucial. If cargo ubiquitination occurs only after detectable SNA3-cargo interaction and requires SNA3, this supports a direct adaptor function. Conversely, if SNA3 affects cargo trafficking without detectable interaction, indirect effects through generally altered endocytic pathways are more likely.

Finally, competition experiments where overexpression of one cargo affects trafficking of another can reveal whether they share common binding sites on SNA3 or are affected through different mechanisms. This comprehensive approach enables researchers to confidently distinguish direct adaptorial functions from indirect effects in the complex cellular environment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.