Recombinant Saccharomyces cerevisiae Protein SYS1 (SYS1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Yeast Physiology

SYS1 is essential for maintaining Golgi integrity and trafficking:

ProcessMechanismKey Interactors
ER-to-Golgi transportBinds COPII via DXE motif to mediate cargo selection during vesicle formationSec23p, Sec24p
Golgi localization of Arl3Required for recruiting Arl1p to the GolgiARL3, ARL1
Endosome-to-Golgi recyclingMulticopy suppressor of ypt6 GTPase mutants defective in retrograde transportYPT6, COG complex

Phenotypic consequences of SYS1 depletion:

  • Accumulation of enlarged cells with nuclear migration defects .

  • Disrupted vacuolar morphology and secretory pathway .

Applications in Biotechnology

Recombinant SYS1 has potential roles in:

  • Vesicle trafficking studies: As a tool to dissect COPII-mediated ER export mechanisms .

  • Industrial protein production: Optimizing yeast strains for secretory pathway efficiency .

  • Disease modeling: Studying human homologs (e.g., ARFRP1) linked to metabolic disorders .

Research Gaps and Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography of SYS1-COPII complexes.

  • Functional redundancy: Investigate why YDJ1 overexpression cannot compensate for SYS1 loss .

  • Industrial scaling: Testing hyper-secreting S. cerevisiae strains (e.g., ΔYPT32 + IRE1 overexpression) for SYS1 production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can fulfill specific format requirements. Please indicate your preference in the order notes and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing it accordingly.
Synonyms
SYS1; YJL004C; J1402; YJR83.17; Protein SYS1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SYS1
Target Protein Sequence
MVSIRRYLRVPNELKPSQIFKQDSLSPSKIGLQIVLLQIFYYTTAIVLFYCWAKLAGYDL NIKEWLFSWENIDFTNAYGLSISLLWLLDSLICVFFLTVIVGRSKLAWDFAITIHAINFI VVFLYTRKFPSFSWFFLQILSSLILIFLGTWTTRWRELRDTFFEGLVDPNEGEVGLVTPS QQHSNHSELEQSPIQLKDLESQI
Uniprot No.

Target Background

Function
SYS1 is essential for targeting ARL3 to the Golgi apparatus, playing a crucial role in protein trafficking. It may serve as a receptor for acetylated ARL3.
Database Links

KEGG: sce:YJL004C

STRING: 4932.YJL004C

Protein Families
SYS1 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Protein SYS1 and what is its primary function?

SYS1 (Sys1p) was originally identified as a high copy number suppressor of Ypt6 GTPase-deficient yeast mutants that exhibit defects in endosome-to-Golgi transport pathways . It functions as an integral membrane protein that plays a critical role in intracellular trafficking, particularly in the export of proteins from the endoplasmic reticulum (ER) to the Golgi apparatus. The protein's suppressor activity is entirely dependent on its 52-53 amino acid long hydrophilic C-terminal tail, which interacts with components of the COPII vesicle coat complex . This interaction facilitates the selection and packaging of specific cargo proteins into transport vesicles during their formation at the ER membrane. Through these mechanisms, SYS1 helps maintain proper protein trafficking pathways that are essential for cellular homeostasis in yeast.

What is the cellular localization of SYS1 in yeast cells?

SYS1 is an integral membrane protein that primarily resides on post-endoplasmic reticulum (ER) organelle(s) . Experimental evidence from protease protection assays demonstrates that the C-terminal tail of SYS1 faces the cytoplasm, making it accessible for interactions with cytosolic proteins such as components of the COPII complex . When membranes of gently lysed cells were subjected to mild proteinase K digestion, the SYS1 C-terminus was easily digested, whereas ER luminal proteins like Kar2p and the Golgi membrane protein Emp47p remained protected . This topology is crucial for SYS1's function, as it positions the functionally important C-terminal domain in the cytoplasm where it can interact with the vesicular transport machinery. The protein contains multiple transmembrane domains with the 20 amino acid segment following the putative transmembrane domain TM4 forming an important functional domain that contributes to its localization and activity .

What structural features are critical for SYS1 function?

The functionality of SYS1 is highly dependent on specific structural elements, particularly within its C-terminal region. The most critical structural feature is the di-acidic Asp-Leu-Glu (DXE) motif located three amino acids from the C-terminal end of the protein . This motif is essential for efficient binding to the Sec23p-Sec24p COPII subcomplex, which mediates vesicle formation at the ER membrane. Importantly, the specific sequence of this motif is crucial, as substitution with a similar Glu-Leu-Glu (EXE) sequence cannot functionally replace the DXE motif in SYS1 . The protein also contains multiple transmembrane domains that anchor it within the membrane, with the C-terminal hydrophilic tail extending into the cytoplasm where it can engage with transport machinery components . This unique structural arrangement allows SYS1 to function as an interface between membrane-bound compartments and cytosolic vesicular trafficking components, facilitating the proper movement of cargo through the secretory pathway.

What experimental approaches are commonly used to study SYS1 localization and trafficking?

Researchers employ several complementary techniques to investigate SYS1 localization and trafficking dynamics. One key approach involves epitope tagging, where the SYS1 gene is modified to express a C-terminally HA-tagged version of the protein, enabling detection with specific antibodies . Subcellular fractionation is then used to separate different cellular compartments, followed by Western blotting to detect the tagged protein in specific fractions. To determine membrane topology, protease protection assays are performed, where membranes from gently lysed cells are subjected to mild proteinase K digestion to assess which protein domains are accessible to the protease .

For studying protein-protein interactions, affinity studies with detergent-solubilized yeast proteins can determine binding partners of SYS1. This approach revealed that the C-terminal 53 amino acid tail of SYS1 binds effectively to the cytoplasmic Sec23p-Sec24p COPII subcomplex . To analyze the functional significance of specific protein domains, researchers create mutant versions of SYS1 with alterations in key motifs (such as the DXE sequence) and assess their localization and activity . Additionally, creating chimeric proteins by adding the SYS1 tail to ER-resident membrane proteins allows for the evaluation of sorting signals and their effects on protein distribution within the cell .

How can researchers generate and purify recombinant SYS1 for in vitro studies?

When generating recombinant SYS1 for in vitro studies, researchers must address challenges associated with membrane protein expression and purification. The process typically begins with cloning the SYS1 gene or specific domains (particularly the cytoplasmic C-terminal domain) into appropriate expression vectors. For full-length SYS1, expression systems that can properly handle membrane proteins are preferred, such as yeast-based expression systems that maintain the native environment for proper folding.

For the soluble C-terminal domain, which contains the critical DXE motif, bacterial expression systems can be employed using affinity tags (His6, GST, etc.) to facilitate purification . After expression, membrane proteins require detergent solubilization before purification, using detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin that maintain protein structure while extracting it from membranes. Affinity chromatography is then used for initial purification, followed by size exclusion chromatography to ensure homogeneity. The purified protein can be verified by Western blotting, mass spectrometry, and circular dichroism to confirm identity, purity, and proper folding. For functional studies, the purified protein can be incorporated into liposomes or used directly in binding assays with putative interaction partners such as the Sec23p-Sec24p complex .

What control experiments are essential when studying SYS1 mutants?

When investigating SYS1 mutants, several critical control experiments must be included to ensure valid and interpretable results. First, expression level verification is essential—Western blotting should confirm that mutant proteins are expressed at levels comparable to wild-type SYS1, as variations in expression could confound phenotypic analyses . Stability assessment through cycloheximide chase experiments helps determine whether observed phenotypes result from altered protein function rather than accelerated degradation.

Localization controls using well-characterized markers for specific organelles (such as Kar2p for the ER and Emp47p for the Golgi) should be included alongside SYS1 localization studies to provide contextual information about subcellular distribution . When studying the DXE motif, researchers should include both deletion mutants and point mutations that alter specific amino acids within the motif to distinguish between effects caused by the absence of the motif versus changes in its properties . Complementation assays where the mutant protein is expressed in cells lacking endogenous SYS1 help determine whether the mutation affects essential functions. Finally, when examining interactions with binding partners like the COPII complex, control proteins with known binding properties (positive control) and non-binding properties (negative control) should be included to validate the specificity of observed interactions .

How does the di-acidic DXE motif in SYS1 interact with the COPII vesicle coat complex?

The interaction between SYS1's di-acidic DXE motif and the COPII complex represents a sophisticated cargo selection mechanism in vesicular transport. The DXE motif located in the C-terminal cytoplasmic tail of SYS1 binds specifically to the Sec23p-Sec24p subcomplex of COPII . This interaction is highly specific—affinity studies with detergent-solubilized yeast proteins demonstrate that substituting the DXE motif with a similar EXE sequence abolishes binding to the COPII components . The specificity extends to the requirements for the first residue in the motif, which must be an aspartic acid rather than glutamic acid, despite both being negatively charged amino acids.

The binding likely involves direct recognition of the DXE motif by a binding pocket on Sec24p, which functions as the main cargo-selection component of the COPII coat. This interaction facilitates the concentration of SYS1 into COPII-coated vesicle buds forming at ER exit sites. When the DXE motif is mutated, approximately 30% of SYS1 protein is retained in the ER at steady state, demonstrating the motif's importance for efficient ER export . Interestingly, the SYS1 tail containing the intact DXE motif can redirect an ER-resident membrane protein to post-ER compartments when added to it as a chimeric construct, confirming that this motif is both necessary and sufficient as a sorting signal for COPII-mediated transport .

What are the molecular mechanisms by which SYS1 suppresses defects in Ypt6 GTPase-deficient yeast mutants?

The suppression of Ypt6 GTPase deficiency by SYS1 involves complex mechanisms related to membrane trafficking pathways. Ypt6 is a Rab GTPase involved in endosome-to-Golgi transport, and its dysfunction leads to defects in this retrograde trafficking pathway . When SYS1 is overexpressed in Ypt6-deficient cells, it can partially restore proper trafficking, suggesting that SYS1 either bypasses the need for Ypt6 or compensates for its absence through parallel pathways.

The suppressor activity of SYS1 is entirely dependent on its C-terminal tail, which contains the di-acidic DXE motif that interacts with the COPII complex . This suggests that enhanced anterograde transport from the ER to the Golgi may compensate for defective retrograde transport in Ypt6 mutants by rebalancing membrane flow between compartments. Alternatively, SYS1 may help stabilize other trafficking machinery components that can partially substitute for Ypt6 function. The interaction of SYS1 with COPII components may facilitate the formation of specialized vesicles that can fuse with appropriate target membranes even in the absence of normal Ypt6-mediated tethering mechanisms. While the exact molecular details remain to be fully elucidated, the suppression likely involves multiple compensatory interactions within the trafficking machinery that together mitigate the effects of Ypt6 deficiency.

How can protein engineering of SYS1 be used to investigate the specificity of di-acidic sorting signals?

Protein engineering of SYS1 provides a powerful platform for investigating the specificity and functionality of di-acidic sorting signals in membrane protein trafficking. By systematically modifying the DXE motif through site-directed mutagenesis, researchers can create a library of variants to determine the exact sequence requirements for efficient ER export. Such studies have already revealed the critical importance of the aspartic acid in the first position, as substitution with glutamic acid (EXE) abolishes the function of this motif in SYS1 .

Further engineering approaches could include:

  • Alanine-scanning mutagenesis of residues surrounding the DXE motif to identify additional contextual elements that influence sorting efficiency

  • Creating chimeric proteins by transplanting the SYS1 C-terminal tail onto various ER-resident proteins to test the universality of the sorting signal

  • Generating point mutations that alter the spacing between the DXE motif and the C-terminus or between the transmembrane domain and the motif

  • Developing fluorescently tagged SYS1 variants with different mutations in the sorting signal to enable real-time visualization of trafficking dynamics

These approaches would provide quantitative data on how variations in di-acidic motifs affect COPII binding affinity, ER export kinetics, and steady-state localization of membrane proteins. A particularly valuable application would be using such engineered variants to screen for suppressors or enhancers of trafficking defects, potentially identifying new components of the sorting machinery.

How does the function of yeast SYS1 compare to similar proteins in mammalian systems?

The functional principles established for yeast SYS1 have significant parallels in mammalian systems, particularly regarding di-acidic export signals. In mammalian cells, the vesicular stomatitis virus glycoprotein (VSVG) utilizes a similar di-acidic DXE motif to mediate efficient ER export . This mechanistic conservation suggests that the basic principles of cargo selection by the COPII machinery are evolutionarily preserved across eukaryotes, despite differences in the complexity of their endomembrane systems.

The study of SYS1 in yeast provides a valuable simplified model for understanding fundamental principles of membrane trafficking that can then be extended to more complex mammalian systems. Research approaches that have proven successful with yeast SYS1, such as mutational analysis of sorting signals and chimeric protein studies, can be applied to mammalian proteins to further elucidate the conservation and diversification of these trafficking mechanisms across evolution.

What insights has the study of SYS1 provided about cargo selection during COPII vesicle formation?

The investigation of SYS1 has provided several fundamental insights into the mechanisms of cargo selection during COPII vesicle formation. Most significantly, it established that in yeast, a di-acidic DXE motif can function as a sorting signal for cargo selection during transport vesicle formation at the ER through direct binding to COPII components . This finding represented the first demonstration of this mechanism in yeast, paralleling similar discoveries in mammalian systems with the VSVG protein.

The study of SYS1 revealed the exquisite specificity of cargo recognition, as even subtle changes to the di-acidic motif (such as substituting DXE with EXE) abolish proper sorting . This highlights how precisely the COPII machinery can discriminate between potential cargo proteins based on small variations in sorting signals. The research also demonstrated that approximately 30% of SYS1 is retained in the ER when the DXE motif is mutated, providing quantitative insights into the efficiency of this sorting mechanism .

Furthermore, experiments showing that the SYS1 tail can redirect an ER-resident protein when added as a chimeric construct established that the di-acidic sorting signal is both necessary and sufficient for COPII-mediated export . This transferability principle has important implications for understanding how cells regulate the composition of different membrane compartments through selective protein trafficking. Finally, the ability of SYS1 to suppress trafficking defects in Ypt6-deficient cells highlights the interconnectedness of anterograde and retrograde trafficking pathways and suggests compensatory mechanisms that cells can employ when specific components of the trafficking machinery are compromised .

How can experimental design be optimized when studying membrane proteins like SYS1?

When studying membrane proteins like SYS1, several key experimental design considerations can optimize research outcomes. The following table outlines specific challenges and recommended approaches:

ChallengeRecommended ApproachRationale
Protein expressionUse homologous expression systems (e.g., yeast for yeast proteins)Maintains native folding environment and post-translational modifications
Membrane extractionTest multiple detergents (DDM, digitonin, CHAPS) at varying concentrationsDifferent detergents vary in their ability to maintain protein structure and function
Detecting protein localizationCombine multiple approaches: fluorescent tagging, fractionation, and protease protection assays Provides complementary data to confirm localization and topology
Studying protein-protein interactionsUse detergent-solubilized proteins in affinity assays with purified binding partners Maintains membrane protein in solution while enabling specific interaction studies
Assessing functional domainsCreate both truncation mutants and point mutations in key motifs (e.g., DXE) Distinguishes between effects of domain absence versus altered functionality

For microscopy-based studies, researchers should employ colocalization with well-characterized organelle markers and consider super-resolution techniques to precisely determine the subcellular distribution of SYS1 and its variants. When analyzing protein trafficking kinetics, pulse-chase experiments combined with specific compartment markers can provide temporal information about protein movement through the secretory pathway.

Control experiments should include wild-type proteins, established mutants with known phenotypes, and appropriate negative controls. When interpreting results, researchers should consider the potential effects of protein overexpression, which may saturate normal trafficking pathways and lead to artificial localization patterns. Finally, complementary approaches such as in vitro reconstitution of vesicle formation using purified components can provide mechanistic insights that cannot be obtained from cellular studies alone.

What are promising approaches for studying SYS1's role in specialized trafficking pathways?

Future research into SYS1's specialized trafficking roles could employ several innovative approaches. Advanced imaging techniques such as lattice light-sheet microscopy combined with CRISPR-Cas9-mediated endogenous tagging would allow real-time visualization of SYS1 dynamics without overexpression artifacts. Such techniques could reveal whether SYS1 participates in specialized vesicle subpopulations or interacts with specific cargo classes beyond what has been previously characterized.

Proximity labeling methods like BioID or TurboID fused to SYS1 would enable comprehensive identification of its protein interaction network under various cellular conditions, potentially uncovering unexpected associations with other trafficking regulators. These approaches could be particularly valuable when combined with genetic backgrounds deficient in specific trafficking components to map compensatory pathways.

Cryo-electron tomography of cells expressing SYS1 variants could provide structural insights into how SYS1 influences vesicle morphology and coat assembly at ER exit sites. Reconstitution experiments using giant unilamellar vesicles (GUVs) containing purified SYS1 and COPII components would allow direct observation of how SYS1 affects membrane deformation and vesicle budding in a controlled environment.

Finally, quantitative proteomic analysis of vesicles formed in the presence of wild-type versus mutant SYS1 could identify specific cargo that depends on SYS1's di-acidic sorting signal for efficient transport, potentially revealing functional specializations not evident from current studies.

How might contradictory results in SYS1 research be reconciled through experimental design?

When researchers encounter contradictory results in SYS1 studies, several experimental design strategies can help reconcile these discrepancies. First, standardization of experimental conditions is critical—variations in yeast strain backgrounds, expression levels, growth conditions, and assay protocols can significantly impact outcomes4. Researchers should conduct side-by-side comparisons using multiple strains to determine whether phenotypic differences are strain-specific.

For contradictory localization data, employing multiple independent methods to assess protein distribution is essential. Combining biochemical fractionation, immunofluorescence microscopy, and electron microscopy provides complementary evidence that can resolve apparent contradictions . When different studies report varying effects of specific mutations, comprehensive dose-response experiments examining protein function across a range of expression levels can determine whether threshold effects explain the discrepancies.

Collaboration between laboratories reporting contradictory results is particularly valuable, allowing direct comparison of materials and methods. Exchange of strains, plasmids, and antibodies can identify whether differences in reagents contribute to variable outcomes. Finally, developing quantitative assays with clear metrics for protein function, rather than relying on qualitative assessments, enables more objective comparison between studies and facilitates resolution of apparently contradictory findings4.

The application of these principles to SYS1 research would enhance reproducibility and accelerate progress toward a unified understanding of this protein's functions in membrane trafficking pathways.

What emerging technologies could advance our understanding of SYS1 and related trafficking proteins?

Several cutting-edge technologies are poised to revolutionize our understanding of SYS1 and related trafficking proteins. CRISPR-based genomic editing combined with split-fluorescent protein tags now allows visualization of endogenous protein dynamics without overexpression artifacts. This approach could reveal the native behavior of SYS1 at physiological expression levels, providing insights into its true trafficking patterns.

Advanced mass spectrometry techniques such as crosslinking mass spectrometry (XL-MS) and hydrogen-deuterium exchange mass spectrometry (HDX-MS) could map the precise interaction interfaces between SYS1's di-acidic motif and the COPII complex, potentially revealing structural rearrangements that occur upon binding. These techniques are particularly valuable for membrane proteins like SYS1 that may be challenging to study by traditional structural biology methods.

The table below summarizes emerging technologies with particular promise for SYS1 research:

TechnologyApplication to SYS1 ResearchPotential Insights
Cryo-electron tomographyVisualize COPII vesicle formation with native or mutant SYS13D architecture of cargo selection complexes
OptogeneticsControl SYS1 localization or interactions with lightTemporal requirements for SYS1 function
Single-molecule trackingFollow individual SYS1 molecules in living cellsKinetics of SYS1 incorporation into transport vesicles
Proximity-dependent biotinylationMap dynamic SYS1 interaction networksNovel binding partners in different trafficking contexts
Microfluidics-based yeast culturesPrecise control of environmental conditionsSYS1 function under various stresses or nutrients

Integration of these technologies with computational approaches such as molecular dynamics simulations could provide unprecedented insights into how subtle changes in the SYS1 sequence influence its interactions with the trafficking machinery. Such multidisciplinary approaches represent the frontier of membrane trafficking research and hold promise for resolving long-standing questions about cargo selection mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.