Recombinant Saccharomyces cerevisiae Protein TOS2 (TOS2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
TOS2; YGR221C; G8523; Protein TOS2; Target of SBF 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
TOS2
Target Protein Sequence
MFSHYRYKENSCQKREAIPDKSRVSLTFLQKRTDSSNVTVAVAVAVPIGAIIIVLSVVLI VVYRRCKKEPSMQDFDPNFEGDLYYLPKMDSSMNSANSDSNATEKRFIYGGYDDFLQPSI ENSQSFKDYVRRINEHAPSAYNIASLASQNNSKLSVPSKHIDLSNKISFESLENSELIVS PQHSNTGQDCDQRCDSTSNPDVNEKSSHNNDNRLKSNYTSRSGLEPQCSREEEENIDRIR SIYNIYFEKSNSTIRSSVTSSIRRDSKLNIATRKSVNMSSQDNPNDTTLIEQSHFGSTTV QEIDSSSSANEEYEDATDYLQVPAPQENKNIASSVYSEVATREKVIPESSLSLTFPPPNG LSTRITSSIYSDTVAKDHIHSAKAPVRALSEGSGQSNLTSAQQYSTYFIDHCNQSNDDNY YYNYPLPLEHPQNYENIGDLPTPTQFIYSTSSHSLTSFKGRPKPPKTLKHVPTARLNGTA LNPMDHPEMFYSSPTKIPSTSLTKQFCTPLPYQLRQSVVMTNPSELSMKPRYKPAGSLRN LIKAQYLPGNSSTTTSSSLSQPPSTLSNAINFRVSGLLDDTDILQPPSVGEILPFKASTE DLRKQLGTSHNYEITPYENVHV
Uniprot No.

Target Background

Function
Involved in anchoring CDC24 to the membrane of polarized growth sites.
Gene References Into Functions
  1. Tos2 exhibits a suggested negative regulatory role in cytokinesis. PMID: 16816427
Database Links

KEGG: sce:YGR221C

STRING: 4932.YGR221C

Protein Families
SKG6/TOS2 family
Subcellular Location
Cell membrane; Single-pass membrane protein. Bud membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of TOS2 protein in Saccharomyces cerevisiae?

TOS2 (Target of SBF 2) is a 622-amino acid protein (UniProt ID: P50078) encoded by the YGR221C gene in Saccharomyces cerevisiae. The amino acid sequence includes distinctive regions with potential membrane-spanning domains as indicated by the hydrophobic stretches in its N-terminal section . The protein's full sequence contains multiple phosphorylation sites and structural motifs that likely mediate protein-protein interactions critical for its cellular functions.

TOS2 belongs to a family of proteins involved in cell polarity establishment and regulation of cell morphogenesis in yeast. While the complete functional characterization remains an active area of research, TOS2 is known to interact with components of the cell polarity machinery and may participate in signaling pathways related to bud site selection and morphogenesis.

What expression systems are most effective for producing recombinant TOS2 protein?

Escherichia coli represents an effective expression system for full-length TOS2 protein production, particularly when fused with an N-terminal His tag for purification purposes . While E. coli offers advantages of high yield and relatively straightforward protocols, researchers should consider several factors when selecting an expression system:

Expression SystemAdvantagesConsiderations for TOS2
E. coliHigh yield, cost-effective, rapid growthLacks post-translational modifications, potential for inclusion bodies
Yeast systemsNative post-translational modifications, proper foldingLower yield than E. coli, longer production time
Mammalian cellsComplex modifications, superior foldingHighest cost, technical complexity, lowest yield

How can I optimize purification protocols for recombinant TOS2?

Optimizing TOS2 purification requires attention to both protein stability and purity. The recommended approach incorporates:

  • Initial preparation: Reconstitute lyophilized TOS2 protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Buffer selection: Tris/PBS-based buffer systems at pH 8.0 have shown effectiveness for maintaining TOS2 stability .

  • Affinity chromatography: Utilize the N-terminal His tag for initial purification using Ni-NTA or cobalt-based resins.

  • Storage optimization: To preserve protein activity, add glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) and create small aliquots to avoid repeated freeze-thaw cycles .

  • Quality control: Verify protein purity via SDS-PAGE (>90% purity should be achievable) and consider additional characterization methods such as mass spectrometry to confirm protein identity.

For applications requiring higher purity, consider implementing size exclusion chromatography as a secondary purification step after initial affinity purification.

What are the critical quality control parameters for assessing TOS2 protein functionality?

Assessing TOS2 functionality extends beyond basic purity checks to include:

  • Structural integrity: Circular dichroism (CD) spectroscopy can confirm proper secondary structure formation, particularly important for the predicted α-helical regions in TOS2.

  • Functional assays: Given TOS2's role in cell polarity, protein-protein interaction assays with known binding partners provide functional validation. Consider co-immunoprecipitation or yeast two-hybrid assays with cell polarity regulators.

  • Phosphorylation status: As TOS2 contains multiple phosphorylation sites, phospho-specific antibodies or mass spectrometry can verify proper post-translational modifications, especially when expressed in eukaryotic systems.

  • Localization studies: Fluorescently tagged TOS2 should exhibit proper subcellular localization in complementation studies using TOS2-deficient yeast strains.

  • Activity measurements: Developing in vitro assays that measure specific biochemical activities associated with TOS2 function.

Researchers should establish quality thresholds for each parameter based on the specific research application, with more stringent requirements for structural studies compared to preliminary functional screening.

How can I troubleshoot expression issues specific to TOS2 protein?

When encountering TOS2 expression challenges, implement this systematic troubleshooting approach:

  • mRNA structural analysis: Calculate the accessibility of the translation initiation site using computational tools. Low accessibility scores (indicating stable secondary structures) correlate strongly with poor expression outcomes. Consider redesigning with synonymous mutations within the first nine codons to increase accessibility .

  • Expression strain selection: Test multiple expression strains with different genetic backgrounds. For challenging proteins like TOS2, specialized strains designed for membrane-associated or hydrophobic proteins may improve yields.

  • Induction protocol optimization: Systematically vary induction parameters including temperature (lower temperatures often improve folding), inducer concentration, and induction timing relative to growth phase.

  • Growth media formulation: Complex media formulations or supplementation with specific amino acids can significantly impact expression. Document the effect of media composition changes on both growth rates and protein yield.

  • Fusion partner screening: If full-length TOS2 expression remains problematic, consider testing a panel of fusion partners (SUMO, MBP, GST) that can enhance solubility while providing alternative purification handles.

For persistent expression issues, consider expressing functional domains of TOS2 separately rather than the full-length protein.

What are the recommended protocols for studying TOS2 interactions with other proteins?

To effectively study TOS2 protein interactions:

  • Co-immunoprecipitation: This technique remains the gold standard for investigating native protein interactions.

    • Express TOS2 with an epitope tag (His, FLAG, or HA) in yeast

    • Prepare cell lysates under non-denaturing conditions

    • Capture TOS2 using appropriate antibodies or affinity resins

    • Identify interacting partners via mass spectrometry

  • Yeast two-hybrid screening: Particularly useful for discovering novel TOS2 interactions.

    • Clone TOS2 into bait plasmids (DNA-binding domain fusions)

    • Screen against prey libraries (activation domain fusions)

    • Validate positive interactions with alternative methods

  • Bimolecular Fluorescence Complementation (BiFC): For visualizing interactions in living cells.

    • Fuse TOS2 and candidate partners to complementary fragments of fluorescent proteins

    • Co-express in yeast cells

    • Analyze fluorescence restoration using microscopy

  • Surface Plasmon Resonance (SPR): For quantitative binding measurements.

    • Immobilize purified TOS2 protein on sensor chips

    • Measure binding kinetics with potential interacting partners

    • Determine association/dissociation constants

MethodMain AdvantagePrimary LimitationRecommended Application
Co-IPPreserves native complexesLimited to stable interactionsInitial screening of physiological interactions
Y2HHigh-throughput capabilityHigh false positive rateDiscovery of potential interactors
BiFCVisualizes interaction locationIrreversible complex formationConfirming interactions in cellular context
SPRProvides quantitative measurementsRequires purified proteinsDetailed binding kinetics analysis

How can I design experiments to assess TOS2's role in cellular processes?

Designing experiments to characterize TOS2's cellular functions should follow this structured approach:

  • Gene deletion studies: Create TOS2 deletion strains (ΔTOS2) in S. cerevisiae using CRISPR-Cas9 or traditional homologous recombination approaches. Document phenotypic changes in growth rate, morphology, stress responses, and cell cycle progression.

  • Complementation experiments: Reintroduce wild-type or mutant versions of TOS2 into deletion strains to validate phenotypes and identify critical functional domains.

  • Localization studies: Use fluorescent protein fusions to track TOS2 localization under various conditions. This approach can reveal dynamic regulation during the cell cycle or in response to environmental stresses.

  • Genetic interaction mapping: Perform synthetic genetic array (SGA) analysis with ΔTOS2 strains to identify genetic interactions revealing functional relationships.

  • Transcriptional profiling: Compare gene expression patterns between wild-type and ΔTOS2 strains using RNA-seq to identify downstream effects of TOS2 deletion.

What bioinformatic approaches can help predict TOS2 structure-function relationships?

Leveraging bioinformatic tools can provide valuable insights into TOS2's structure and function:

  • Sequence-based predictions:

    • Identify conserved domains through PFAM, SMART, or InterPro analysis

    • Predict secondary structure elements using PSIPRED or JPred

    • Locate potential post-translational modification sites using NetPhos or similar tools

    • Detect transmembrane regions using TMHMM or Phobius

  • Structural modeling:

    • Generate 3D structural models using AlphaFold2 or RoseTTAFold

    • Identify potential ligand-binding sites through CASTp or SiteMap

    • Assess model quality using ProSA or QMEAN

  • Evolutionary analysis:

    • Perform multiple sequence alignments of TOS2 homologs using MUSCLE or T-Coffee

    • Conduct phylogenetic analysis to identify evolutionary relationships

    • Calculate evolutionary conservation scores using ConSurf to highlight functionally important residues

  • Network analysis:

    • Integrate protein-protein interaction data from databases like BioGRID or STRING

    • Identify functional clusters in the TOS2 interaction network

    • Predict functional relationships through gene ontology enrichment

These computational analyses can guide experimental design by identifying regions of interest for mutagenesis studies or potential interaction sites worthy of focused investigation.

How can TOS2 be utilized as a model for studying recombinant protein expression optimization?

TOS2 protein provides an excellent model system for studying general principles of recombinant protein expression optimization due to its moderately complex structure and expression characteristics:

  • Translation initiation optimization: Apply the principles of mRNA accessibility to TOS2 expression by modifying the 5' coding region. Research has demonstrated that the accessibility of translation initiation sites, modeled using mRNA base-unpairing across the Boltzmann's ensemble, significantly outperforms alternative features in predicting expression success .

  • Host strain engineering: Develop specialized expression strains by targeting regulatory pathways known to affect recombinant protein production. For example, modifications to the multidrug resistance (MDR) pathway through mutations in PDR1, PDR3, or YRR1 transcription factors can significantly improve cellular tolerance and protein production capacity .

  • Stress response modulation: Engineer expression hosts by removing the eIF2 kinase Gcn2, which has been shown to double recombinant protein productivity while reducing oxidative stress markers . This approach addresses translation attenuation that occurs during recombinant protein overexpression.

  • Expression cassette design: Compare different promoter-terminator combinations and replicon types to optimize TOS2 expression. Transposon systems like Tol2 coupled with selection markers have shown promise for establishing stable, high-producing cell lines .

By systematically testing these approaches with TOS2 as a model protein, researchers can develop generalizable principles applicable to other challenging recombinant proteins.

What are the most effective experimental designs for studying TOS2's role in cell polarity and morphogenesis?

To investigate TOS2's role in cell polarity and morphogenesis, consider these experimental approaches:

  • Time-lapse microscopy: Track fluorescently tagged TOS2 along with markers for cell polarity components (e.g., Cdc42, Spa2) during bud emergence and development.

  • Protein domain dissection: Create a library of truncated TOS2 variants to map functional domains and their roles in localization and function.

  • Phosphorylation site mapping: Systematically mutate predicted phosphorylation sites to phosphomimetic (S/T to D/E) or phosphodeficient (S/T to A) variants to assess the impact on TOS2 function and localization.

  • Synchronized culture analysis: Use α-factor arrest/release or elutriation to synchronize yeast cultures and analyze TOS2 expression, localization, and modification through the cell cycle.

  • Stress response experiments: Expose cells to various stressors (osmotic, oxidative, thermal) and monitor changes in TOS2 localization and function to identify conditional phenotypes.

The most informative experimental designs will combine multiple approaches, particularly correlating changes in TOS2 localization or modification status with observable phenotypic outcomes in cellular morphology or polarity.

How can I integrate TOS2 studies with systems biology approaches?

Integrating TOS2 research within systems biology frameworks enables comprehensive understanding of its cellular functions:

  • Multi-omics integration: Combine proteomics, transcriptomics, and metabolomics data from wild-type and TOS2-modified strains to create comprehensive network models. This approach can reveal unexpected connections between TOS2 and cellular processes.

  • Quantitative modeling: Develop mathematical models incorporating TOS2's interactions and dynamics within polarity establishment pathways. These models can generate testable predictions about system behaviors under various perturbations.

  • High-content screening: Deploy systematic genetic or chemical perturbations in TOS2-modified strains, using automated microscopy and image analysis to quantify phenotypic effects across multiple parameters simultaneously.

  • Protein-protein interaction networks: Construct comprehensive interaction networks centered on TOS2, using techniques like BioID or proximity labeling to identify both stable and transient interaction partners.

  • Comparative genomics: Analyze TOS2 homologs across fungal species, correlating functional differences with evolutionary changes in sequence or regulation.

When implementing these approaches, maintain focus on falsifiable hypotheses and ensure that computational predictions are validated through targeted experimental studies.

How might experimental evolution approaches inform TOS2 protein engineering?

Experimental evolution offers powerful approaches for TOS2 protein engineering:

  • Directed evolution strategies: Apply selective pressure to identify TOS2 variants with enhanced properties. Research has shown that experimental evolution of S. cerevisiae for adaptive traits can identify beneficial mutations in regulatory pathways that might be applicable to TOS2 optimization .

  • Mutation-function mapping: Systematic characterization of mutations arising during experimental evolution can reveal previously unknown functional domains in TOS2. Studies with other yeast proteins have demonstrated that mutations in transcription factors like PDR1, PDR3, and YRR1 can confer significant adaptive advantages .

  • Cross-species comparative analysis: Examining TOS2 homologs that have evolved in different yeast species can identify conserved functional elements and species-specific adaptations.

  • Epistasis mapping: Combining experimental evolution with systematic genetic backgrounds (e.g., deletion libraries) can reveal genetic interactions that influence TOS2 function and provide insight into its regulatory networks.

Researchers should note that successful experimental evolution approaches require carefully designed selection schemes that specifically target the desired TOS2 properties rather than allowing adaptation through alternative pathways.

What emerging technologies might enhance future TOS2 research?

Several cutting-edge technologies hold promise for advancing TOS2 research:

  • CRISPR-based tools: Beyond gene editing, CRISPR technologies enable precise modulation of TOS2 expression (CRISPRa/CRISPRi), visualization of the genomic locus (CRISPR-imaging), and high-throughput functional screening .

  • Single-cell analysis: Technologies that enable single-cell transcriptomics, proteomics, or metabolomics can reveal cell-to-cell variability in TOS2 expression and function that might be masked in population-level studies.

  • Cryo-electron microscopy: Advanced structural biology techniques can potentially resolve TOS2's structure in complex with interaction partners, providing unprecedented insights into its molecular function.

  • Microfluidic approaches: Continuous culture systems with precise environmental control enable real-time monitoring of TOS2 dynamics under various conditions or perturbations.

  • Synthetic biology frameworks: Designer genetic circuits incorporating TOS2 can test hypotheses about its function in controlled contexts and potentially develop novel applications.

As these technologies continue to mature, their integration with traditional biochemical and genetic approaches will likely accelerate our understanding of TOS2's complex roles in cellular processes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.