Recombinant Saccharomyces cerevisiae Protein transport protein SFT2 (SFT2)

Shipped with Ice Packs
In Stock

Description

Introduction to SFT2 Protein

SFT2 is a non-essential tetra-spanning membrane protein predominantly localized to the late Golgi apparatus in the yeast Saccharomyces cerevisiae. Initially identified through a genetic screen for suppressors of sed5 temperature-sensitive mutations, SFT2 has emerged as a critical component in vesicular trafficking pathways . The protein plays a significant role in membrane fusion events, particularly in the context of SNARE (Soluble N-ethylmaleimide-sensitive factor Attachment protein REceptor) recycling during cellular stress responses .

While SFT2 is non-essential under normal growth conditions, recent research has uncovered its importance during ER stress, where it functions downstream of the Arl1-Imh1 axis to facilitate proper SNARE protein recycling. This function becomes particularly crucial when cells are exposed to stressors such as tunicamycin, which induces ER stress by inhibiting protein glycosylation .

Domain Organization and Functional Regions

Recent research has highlighted the importance of the N-terminal region of SFT2 for its cellular function. Deletion studies have demonstrated that the first 40 amino acids are critical for SFT2-mediated SNARE recycling under ER stress conditions. Specifically, a truncated variant lacking these 40 residues (Sft2 dN40) fails to restore proper localization of SNARE proteins Tlg1 and Snc1 in SFT2-deleted cells under ER stress .

Similarly, variants with 80 N-terminal amino acids deleted (Sft2 dN80) also exhibited functional deficiencies. Interestingly, C-terminal truncations (removal of the last 22 amino acids) did not significantly impair the protein's ability to support SNARE recycling, indicating that the C-terminus is less critical for this particular function .

Subcellular Localization and Trafficking

SFT2 primarily localizes to the late Golgi compartment under normal growth conditions. Immunofluorescence studies have confirmed its colocalization with late Golgi markers such as Sec7, as well as with Arl1 and Imh1 proteins, indicating its presence in proximity to the Arl1-Imh1 axis within the late Golgi complex .

Under conditions of ER stress induced by tunicamycin treatment, SFT2 has been observed to colocalize with amplified puncta formed by Arl1-Imh1 proteins, suggesting dynamic changes in its localization pattern in response to cellular stress . This stress-induced relocalization appears to be functionally significant for the protein's role in maintaining proper vesicular trafficking during ER stress.

SFT2 in SNARE Recycling

One of the primary functions of SFT2 is its involvement in the recycling transport of SNARE proteins, particularly Tlg1 and Snc1, under ER stress conditions. Studies have demonstrated that deletion of SFT2 (sft2Δ) leads to mislocalization of these SNAREs similar to the phenotype observed in imh1Δ cells when treated with tunicamycin .

Interaction with the Arl1-Imh1 Axis

Recent research has established SFT2 as a downstream effector of the Arl1-Imh1 axis, a critical regulatory module in vesicular trafficking. The Arl1-Imh1 axis is activated during ER stress, leading to enhanced recruitment of Golgin Imh1 to the late Golgi. SFT2 functions downstream of this axis to regulate SNARE recycling under stress conditions .

Interestingly, the proper localization and function of SFT2 in the late Golgi during ER stress depends on Imh1-mediated retrograde transport of another SNARE protein, Tlg2. This creates a sequential cascade where Imh1 regulates Tlg2 transport to the late Golgi, which is then required for the proper targeting of SFT2 to this compartment under stress conditions .

Redundancy with Got1p

SFT2 exhibits functional redundancy with another membrane protein, Got1p. While Got1p primarily facilitates Sed5p-dependent fusion events in the early Golgi, SFT2 appears to perform related functions in the late Golgi . This functional overlap is evidenced by the observation that individual deletion of either SFT2 or GOT1 does not significantly affect Snc1 recycling under normal conditions, whereas simultaneous inactivation of both proteins results in severe defects in endosome-Golgi traffic .

Complete removal of both SFT2 and GOT1 leads to an ER-Golgi transport defect, indicating that at least one of these proteins is required for vesicle fusion with the Golgi complex in vivo . This suggests that Got1p and SFT2 serve as complementary components in maintaining the integrity of vesicular trafficking pathways.

SFT2 Function Under Tunicamycin-Induced Stress

In sft2Δ cells exposed to tunicamycin, Snc1 accumulates in the late Golgi rather than its normal plasma membrane localization, and Tlg1 displays aberrant distribution. This stress-specific requirement for SFT2 function highlights its role as a conditional regulator of vesicular trafficking that becomes critical when cells encounter ER stress .

Interaction with GARP Complex

SFT2 has been implicated in GARP (Golgi-associated retrograde protein)-dependent endosome-to-Golgi transport, particularly in the absence of the Rab protein Ypt6. The GARP complex is involved in tethering endosome-derived vesicles to the trans-Golgi network, and SFT2 appears to facilitate this process under specific conditions .

Research has demonstrated that SFT2 is required for the Arl1-Imh1 axis to reverse Ypt6 dysfunction in SNARE recycling, suggesting it serves as an alternative pathway for maintaining vesicular trafficking when the primary Ypt6-dependent mechanism is compromised .

Recombinant SFT2 Protein Production

Recombinant full-length Saccharomyces cerevisiae protein transport protein SFT2 has been successfully produced for research applications. The commercially available recombinant protein typically consists of the full-length sequence (amino acids 1-215) fused to an N-terminal histidine tag to facilitate purification .

Expression and Purification

The recombinant SFT2 protein is commonly expressed in Escherichia coli expression systems, which provide an efficient platform for producing soluble protein in sufficient quantities for biochemical and structural studies . The protein is typically purified through affinity chromatography using the His-tag, followed by additional purification steps to achieve high purity (greater than 90% as determined by SDS-PAGE) .

Physical and Chemical Properties

The purified recombinant SFT2 protein is generally provided as a lyophilized powder and can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is recommended to add glycerol (5-50% final concentration) and store aliquots at -20°C or -80°C to prevent degradation .

Table 1: Physical and Chemical Properties of Recombinant SFT2 Protein

PropertySpecification
SpeciesSaccharomyces cerevisiae
Expression SystemE. coli
TagN-terminal His-tag
Protein LengthFull Length (1-215 amino acids)
FormLyophilized powder
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Optimal Storage-20°C/-80°C with added glycerol (5-50%)

Protein-Protein Interaction Analyses

The recombinant protein is particularly useful for investigating the interactions between SFT2 and its binding partners, including SNARE proteins such as Tlg1 and components of the Arl1-Imh1 axis. These studies are essential for mapping the network of protein-protein interactions that underlie vesicular trafficking pathways .

Research has demonstrated that the N-terminus of SFT2 is important for enhancing the interaction between Tlg1 and Snc1, suggesting that SFT2 may function as a mediator or scaffold in assembling SNARE complexes during vesicular fusion events .

Functional Reconstitution

Recombinant SFT2 protein can be used in functional reconstitution experiments to recapitulate aspects of vesicular trafficking in artificial membrane systems. Such studies provide a reductionist approach to dissecting the specific contributions of SFT2 to membrane fusion events and SNARE complex assembly .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery times, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be decided during production. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
SFT2; YBL102W; YBL0812; Protein transport protein SFT2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SFT2
Target Protein Sequence
MSEEPPSDQVNSLRDSLNRWNQTRQQNSQGFNESAKTLFSSWADSLNTRAQDIYQTLPVS RQDLVQDQEPSWFQLSRTERMVLFVCFLLGATACFTLCTFLFPVLAAKPRKFGLLWTMGS LLFVLAFGVLMGPLAYLKHLTARERLPFSMFFFATCFMTIYFAAFSKNTVLTITCALLEL VAVIYYAISYFPFGATGLRMLSSAGVNSARGVLRI
Uniprot No.

Target Background

Function
SFT2 is a nonessential protein involved in the fusion of transport vesicles derived from the endocytic pathway with the Golgi complex. It can be partially replaced by GOT1.
Database Links

KEGG: sce:YBL102W

STRING: 4932.YBL102W

Protein Families
SFT2 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is the basic function of SFT2 in Saccharomyces cerevisiae?

SFT2 (Suppressor of Sed Five Ts mutant 2) functions primarily as a membrane protein involved in vesicular trafficking to the Golgi apparatus. It plays a critical role in facilitating the fusion of transport vesicles with Golgi membranes, particularly during stress conditions. SFT2 works in the late Golgi compartment and has been demonstrated to mediate endosome-to-Golgi retrograde transport of SNARE proteins, which are essential components of the membrane fusion machinery .

Mechanistically, SFT2 functions downstream of the Arl1-Imh1 axis, a regulatory pathway that becomes particularly important during ER stress conditions. Studies show that SFT2 facilitates the proper localization and recycling of SNARE proteins such as Tlg1 and Snc1, ensuring their proper transport between the endosome and Golgi apparatus . While SFT2 deletion alone shows no obvious phenotype under normal growth conditions, it becomes essential when cells experience ER stress, indicating its role as a stress-responsive trafficking component .

How is SFT2 structurally organized?

SFT2 is a tetra-spanning membrane protein with four transmembrane domains. The protein has a structure that creates both N-terminal and C-terminal cytoplasmic domains, with the N-terminus playing a particularly critical role in its function .

Structural studies have identified that:

  • The N-terminal domain (first 40 amino acids) is essential for SFT2 function in regulating SNARE recycling transport, particularly under ER stress conditions. Deletion of these 40 amino acids (Sft2 dN40) results in defective mediation of SNARE recycling and decreased association with the SNARE protein Tlg1 .

  • The C-terminal domain (last 22 amino acids) appears to be dispensable for SFT2's core functions, as truncated versions lacking this region (Sft2 dC) can still restore proper localization of Tlg1 and Snc1 in SFT2-deleted cells under ER stress conditions .

  • SFT2 shares similar membrane topology with Got1p, another Golgi trafficking protein, suggesting potential functional overlap, which is supported by their genetic and functional interactions .

What phenotypes are associated with SFT2 deletion in yeast?

The phenotypic manifestations of SFT2 deletion vary depending on growth conditions and genetic background:

  • Under normal growth conditions: Yeast strains lacking SFT2 (sft2Δ) grow normally and show no obvious secretory defects. This indicates that SFT2 is not essential for basic cellular functions in optimal environments .

  • Under ER stress conditions (e.g., tunicamycin treatment): SFT2 deletion results in mislocalization of SNARE proteins, particularly Tlg1 and Snc1. These SNAREs fail to properly recycle between the endosome and Golgi apparatus, demonstrating that SFT2 becomes crucial during cellular stress responses .

  • In combination with GOT1 deletion: Simultaneous deletion of both SFT2 and GOT1 results in more severe phenotypes:

    • Defects in endosome-to-Golgi trafficking

    • Impaired ER-to-Golgi transport

    • Growth defects that are not observed in either single deletion mutant

This synthetic interaction suggests that SFT2 and Got1p perform partially redundant functions in facilitating vesicle fusion with the Golgi complex, with Got1p acting primarily in early Golgi and SFT2 in late Golgi compartments .

How does SFT2 interact with the SNARE machinery?

SFT2 functions as a SNARE-associated protein that facilitates proper trafficking and recycling of SNARE proteins, which are essential components of the membrane fusion machinery. Its specific interactions include:

  • Direct association with the SNARE protein Tlg1, which is enhanced under ER stress conditions. This interaction appears to be mediated primarily through the N-terminal domain of SFT2 .

  • Indirect regulation of Snc1 SNARE localization. When SFT2 is deleted under ER stress conditions, Snc1 accumulates in intracellular compartments rather than properly localizing to the plasma membrane .

  • Functional relationship with Sed5p, a syntaxin family SNARE protein present in early Golgi cisternae. SFT2 was originally identified as a suppressor of temperature-sensitive mutations in SED5, suggesting genetic interaction between these components .

  • Dependency on Tlg2 for recruitment to the late Golgi under ER stress. This indicates a sequential assembly of trafficking components where Imh1 regulates Tlg2 retrograde transport, which in turn is required for SFT2 targeting to the late Golgi .

How does the Arl1-Imh1-SFT2 axis regulate SNARE trafficking under ER stress?

The Arl1-Imh1-SFT2 axis represents a regulatory pathway that becomes critical during ER stress conditions. This pathway operates through a sequential mechanism:

  • ER stress enhances Arl1 activation and recruitment of the Golgin protein Imh1 to the late Golgi .

  • Activated Imh1 regulates the retrograde transport of Tlg2 to the late Golgi .

  • Tlg2 is required for proper targeting of SFT2 to the late Golgi membranes .

  • SFT2, once properly localized, mediates the recycling of Tlg1/Snc1 SNAREs through its N-terminal domain .

Experimental evidence demonstrates that disruption at any point in this pathway leads to similar phenotypes in terms of SNARE mislocalization. For instance, deletion of either ARL1, IMH1, or SFT2 results in comparable defects in Tlg1/Snc1 localization under ER stress. This suggests a linear pathway where each component depends on the previous one for proper function .

Methodologically, researchers can investigate this pathway by:

  • Using tunicamycin treatment to induce ER stress in yeast cells

  • Employing fluorescently tagged SNARE proteins to monitor their localization

  • Using latrunculin B to inhibit endocytosis and distinguish between anterograde and retrograde trafficking defects

  • Creating deletion mutants of pathway components and assessing synthetic interactions

What are the recommended methodologies for studying SFT2 function in vesicular trafficking?

Investigating SFT2 function in vesicular trafficking requires a multi-faceted methodological approach:

  • In vitro trafficking assays:

    • While SFT2 mutants alone do not show defects in in vitro ER-Golgi transport assays, combined deletion with GOT1 does. Researchers should employ reconstituted in vitro systems where vesicle tethering and fusion can be separately assessed .

    • The assay should measure steps after vesicle tethering to Golgi membranes, as this is where SFT2/Got1p function is most evident .

  • Live-cell fluorescence microscopy:

    • GFP-tagged SNARE proteins (Tlg1, Snc1) serve as excellent reporters for SFT2 function .

    • Colocalization studies with organelle markers (e.g., Sec7 for late Golgi) can reveal compartment-specific defects .

    • Time-lapse imaging can capture dynamic aspects of protein recycling and transport.

  • Stress induction protocols:

    • Tunicamycin treatment (typically 2.5 μg/ml for 2 hours) is the established method to induce ER stress and reveal SFT2-dependent phenotypes that are not apparent under normal conditions .

    • Latrunculin B treatment can help distinguish whether observed phenotypes result from defects in anterograde or retrograde trafficking .

  • Protein-protein interaction studies:

    • Immunoprecipitation assays to detect physical interactions between SFT2 and SNAREs like Tlg1 .

    • Yeast two-hybrid or proximity ligation assays to map interaction domains.

    • Truncation mutants (particularly N-terminal deletions) to identify functional domains .

How can researchers distinguish between the functions of SFT2 and Got1p?

Distinguishing between SFT2 and Got1p functions requires specific experimental approaches due to their partial functional redundancy:

  • Subcellular localization analysis:

    • SFT2 is primarily located in the late Golgi compartment and colocalizes with late Golgi markers like Sec7, Arl1, and Imh1 .

    • Got1p is found in early Golgi cisternae and partially colocalizes with Sed5p .

    • Immunofluorescence microscopy with compartment-specific markers can reveal their distinct distributions.

  • Genetic interaction studies:

    • Synthetic lethality screens have revealed that SFT2 and GOT1 have unique genetic interaction profiles .

    • SFT2 shows genetic interactions with SED5 and VPS3, while GOT1 has distinct interaction patterns .

    • Researchers should perform epistasis analysis by creating double and triple mutants with interacting genes.

  • Condition-specific requirements:

    • Under normal conditions, neither single deletion shows obvious phenotypes.

    • Under ER stress, SFT2 but not GOT1 is required for Tlg1 recycling, while both affect Snc1 recycling .

    • Researchers should therefore test multiple trafficking markers under various stress conditions.

  • Functional complementation:

    • Expression of truncated versions of SFT2 can restore function in sft2Δ cells but not got1Δ cells .

    • Cross-complementation experiments where overexpression of one protein is tested for its ability to rescue defects in the other's absence can reveal functional overlap and specificity.

ProteinPrimary LocalizationFunction Under Normal ConditionsFunction Under ER StressKey Protein Interactions
SFT2Late GolgiNon-essential for growthRequired for Tlg1/Snc1 SNARE recyclingTlg1, Tlg2, Imh1, Arl1
Got1pEarly GolgiFacilitates Sed5p-dependent fusionRequired for Snc1 (but not Tlg1) recyclingSed5p

What experimental approaches can resolve contradictory findings about SFT2 function?

Several apparent contradictions exist in the literature regarding SFT2 function. Researchers can resolve these using the following approaches:

  • Condition-dependent phenotypes:

    • The observation that SFT2 deletion shows no phenotype under normal conditions but severe defects under ER stress can be resolved by systematically testing a range of stress conditions (tunicamycin concentrations, DTT treatment, heat shock, etc.) with standardized assays for trafficking .

    • Researchers should employ dose-response and time-course analyses to identify subtle phenotypes that might be missed in endpoint assays.

  • Genetic background effects:

    • Different yeast strain backgrounds may show variable phenotypic severity. Researchers should perform experiments in multiple strain backgrounds and document genetic markers comprehensively.

    • Backcrossing strains to a common reference strain can help normalize genetic background effects.

  • Functional redundancy issues:

    • The partial redundancy between SFT2 and Got1p explains why single deletions often show mild phenotypes .

    • Beyond creating double mutants, researchers should consider creating an "anchor-away" system or rapid protein degradation approaches to acutely remove proteins and bypass adaptive responses.

  • Assay sensitivity concerns:

    • In vitro transport assays may lack the sensitivity to detect subtle defects in SFT2 single mutants.

    • Researchers should develop more sensitive assays such as:

      • Single-vesicle fusion assays using total internal reflection fluorescence (TIRF) microscopy

      • Quantitative proteomics of isolated Golgi or transport vesicle fractions

      • Super-resolution microscopy to detect subtle changes in protein distribution

How can SFT2 functional domains be mapped for structure-function studies?

Mapping SFT2 functional domains requires a systematic approach combining molecular biology, biochemistry, and cell biology techniques:

  • Truncation and deletion analysis:

    • Create a series of N-terminal and C-terminal truncations beyond the established Sft2 dN40, Sft2 dN80, and Sft2 dC constructs .

    • Create internal deletions that remove individual transmembrane domains or connecting loops.

    • Test these constructs for their ability to rescue sft2Δ phenotypes under ER stress.

  • Site-directed mutagenesis:

    • Identify conserved amino acids through multiple sequence alignments of SFT2 across fungal species.

    • Create alanine-scanning mutations of conserved residues, particularly in the critical N-terminal 40 amino acids.

    • Test mutants for localization, protein interactions, and functional complementation.

  • Domain swapping experiments:

    • Create chimeric proteins where domains of SFT2 are replaced with corresponding regions from Got1p or other tetra-spanning membrane proteins.

    • This approach can identify domains that confer specificity for late versus early Golgi function.

  • Structural biology approaches:

    • While no high-resolution structure is currently available for SFT2, researchers can use:

      • Cryo-electron microscopy of purified SFT2 in nanodiscs

      • Cross-linking mass spectrometry to identify residues in close proximity

      • Computational modeling approaches similar to those used for other membrane proteins

Based on current data, this N-terminal region (amino acids 1-40) appears to be critical for SFT2's ability to interact with Tlg1 and facilitate SNARE recycling under ER stress, making it a priority target for detailed mapping studies .

What are the best expression systems for recombinant SFT2 production?

For successful recombinant production of functional Saccharomyces cerevisiae SFT2, researchers should consider the following expression systems and methodologies:

  • Homologous expression in S. cerevisiae:

    • This approach maintains the native cellular environment and post-translational modifications.

    • Recommended vectors include pRS series (e.g., pRS416) for moderate expression or GAL1 promoter-based vectors for inducible high-level expression.

    • For functional studies, N-terminal GFP-tagging has been validated and shown to maintain biological function both in vivo and in vitro .

    • Include an affinity tag (His6 or FLAG) for purification purposes.

  • Bacterial expression systems:

    • Expression of full-length SFT2 in E. coli is challenging due to its multiple transmembrane domains.

    • For the cytoplasmic domains (particularly the important N-terminal region), standard bacterial expression systems like pET series vectors in BL21(DE3) strains can be used.

    • Consider fusion partners like maltose-binding protein (MBP) or thioredoxin to improve solubility of the N-terminal domain.

  • Insect cell expression:

    • For full-length SFT2, baculovirus expression in Sf9 or Hi5 cells provides a eukaryotic environment with proper folding machinery.

    • The BAC-to-BAC system with a C-terminal His8 tag and TEV protease cleavage site offers good flexibility for purification.

  • Truncation strategies:

    • Similar to successful studies with other membrane proteins, researchers should consider expressing SFT2 with the C-terminal 22 amino acids removed, as this region has been shown to be dispensable for function .

    • For biochemical characterization, focus on the N-terminal 40 amino acids that are critical for function .

What are the most reliable assays for measuring SFT2-dependent vesicular trafficking?

Several complementary assays can reliably measure SFT2-dependent trafficking, each with specific advantages:

  • Fluorescence microscopy-based trafficking assays:

    • GFP-tagged Snc1 and mCherry-tagged Tlg1 serve as excellent reporters for SFT2 function .

    • Quantitative metrics should include:

      • Plasma membrane-to-intracellular ratio for Snc1

      • Colocalization coefficients with Golgi markers for Tlg1

      • Number and size of punctate structures

  • Biochemical fractionation approaches:

    • Differential centrifugation followed by immunoblotting for SNAREs can reveal compartment-specific accumulation.

    • Density gradient fractionation can separate distinct Golgi compartments and endosomes.

    • Protease protection assays can determine the topology of accumulated proteins.

  • Cargo trafficking kinetics:

    • Pulse-chase experiments with inducible fluorescent cargo proteins

    • Quantitative measurement of secreted reporter proteins (e.g., invertase or acid phosphatase)

    • SNAP-tag or HaloTag-based pulse-chase imaging for single-cell trafficking dynamics

  • In vitro reconstitution assays:

    • Using semi-intact cells or purified organelles to measure:

      • SNARE complex assembly rates

      • Vesicle tethering efficiency

      • Vesicle fusion using lipid-mixing assays with fluorescent lipids

  • Stress-responsive assay conditions:

    • Always include appropriate controls with and without ER stress induction (2.5 μg/ml tunicamycin is standard) .

    • Include latrunculin B treatments to distinguish endocytosis defects from secretory defects .

    • Consider temperature shifts as an alternative stress condition.

How can researchers develop effective animal models to study SFT2 homologs?

While SFT2 was first characterized in yeast, studying its homologs in higher organisms requires careful consideration:

  • Model organism selection:

    • Caenorhabditis elegans: The SFT2 homolog can be studied using RNAi knockdown or CRISPR/Cas9 genome editing.

    • Drosophila melanogaster: The conserved nature of membrane trafficking makes this a suitable model for studying SFT2 function in a multicellular context.

    • Zebrafish: For vertebrate models, zebrafish offer advantages of optical transparency and rapid development.

    • Mammals: While no direct homologs of SFT2 have been definitively identified in humans, FBH1 and PARI are potential candidates that should be investigated .

  • Genetic modification strategies:

    • CRISPR/Cas9 genome editing to create knockout models, introducing precise mutations that mimic the sft2 dN40 deletion that affects function in yeast .

    • Conditional knockout approaches using Cre-lox systems to study tissue-specific functions.

    • Knockin of fluorescent tags at endogenous loci to study localization patterns without overexpression artifacts.

  • Phenotypic analysis approaches:

    • For C. elegans and Drosophila, focus on secretory cell types (e.g., salivary glands) for initial phenotypic characterization.

    • In vertebrates, examine polarized epithelial cells where Golgi trafficking plays critical roles.

    • Stress-responsive phenotypes should be evaluated using tunicamycin or other ER stress inducers, mirroring the conditions where SFT2 function becomes critical in yeast .

  • Functional rescue experiments:

    • Test whether yeast SFT2 can rescue phenotypes in animal models to determine functional conservation.

    • Create chimeric proteins with domains from yeast and animal homologs to map functionally conserved regions.

How can researchers investigate the role of SFT2 in human disease models?

While SFT2 homologs in humans have not been definitively established, several research approaches can investigate potential connections to disease:

  • Identification of human functional homologs:

    • Bioinformatic analyses using sequence similarity and structural prediction tools

    • Functional complementation studies testing whether human candidates can rescue yeast sft2Δ phenotypes

    • CRISPR screens in human cell lines to identify genes that phenocopy known SFT2-related trafficking defects when deleted

  • Disease association studies:

    • Focus on diseases associated with intracellular trafficking defects, particularly those affecting the Golgi apparatus

    • Prioritize neurodegenerative diseases where SNARE function is critical

    • Examine rare genetic disorders with unexplained Golgi morphology or trafficking phenotypes

  • Cell culture models:

    • Create cellular stress models using tunicamycin to induce ER stress in human cell lines

    • Examine trafficking of disease-relevant cargo proteins under stress conditions

    • Use proximity labeling approaches (BioID, APEX) to identify interaction partners of candidate human homologs

  • Therapeutic targeting strategies:

    • If human homologs are validated, consider:

      • Small molecule screens to identify compounds that can restore trafficking in cells lacking the homolog

      • Structure-based drug design targeting the N-terminal domain, which is critical for function in yeast

      • Gene therapy approaches to restore expression in affected tissues

What are the remaining key questions in SFT2 research?

Despite significant advances in understanding SFT2 function, several key questions remain unanswered:

  • Molecular mechanism of action:

    • How does SFT2 physically facilitate SNARE-mediated membrane fusion?

    • What is the precise role of the N-terminal 40 amino acids in mediating interactions with SNAREs?

    • Does SFT2 undergo conformational changes during vesicle docking and fusion?

  • Stress-responsive regulation:

    • What is the molecular mechanism by which ER stress enhances SFT2 function?

    • Are there post-translational modifications of SFT2 that occur during stress responses?

    • How is SFT2 targeted for degradation or recycling after fulfilling its function?

  • Evolutionary conservation:

    • What are the true functional homologs of SFT2 in higher organisms?

    • Why has functional redundancy between SFT2 and Got1p been maintained throughout evolution?

    • Are there tissue-specific variations in SFT2 homolog function in multicellular organisms?

  • Disease relevance:

    • Are there human diseases associated with dysfunction of SFT2 homologs?

    • Could modulation of SFT2-like proteins offer therapeutic potential for disorders of membrane trafficking?

Addressing these questions will require interdisciplinary approaches combining structural biology, cell biology, genetics, and disease modeling. Future research should focus particularly on the stress-responsive nature of SFT2 function, as this appears to be its most critical and non-redundant role.

What are the recommended next steps for researchers entering the SFT2 field?

For researchers entering the SFT2 field, the following strategic approaches are recommended:

  • Methodological foundations:

    • Establish reliable assays for SFT2-dependent trafficking in your laboratory, focusing particularly on stress-induced conditions with tunicamycin .

    • Develop fluorescent reporter constructs for key cargo proteins (Tlg1, Snc1) and organelle markers.

    • Create a panel of SFT2 mutants, particularly focusing on the critical N-terminal domain .

  • Priority research directions:

    • Structure-function analysis of the N-terminal domain, which appears critical for SFT2 function .

    • Identification and validation of mammalian homologs or functional equivalents of SFT2.

    • Detailed characterization of the SFT2 interactome under normal versus stress conditions.

    • Investigation of additional stress conditions beyond tunicamycin that might require SFT2 function.

  • Collaborative approaches:

    • Partner with structural biologists to determine the three-dimensional structure of SFT2.

    • Engage with systems biologists to place SFT2 function in broader pathway contexts.

    • Collaborate with clinicians to investigate potential disease connections.

  • Technical innovations to consider:

    • Develop improved in vitro reconstitution systems for membrane trafficking events.

    • Apply advanced imaging techniques like super-resolution microscopy to visualize SFT2-dependent events.

    • Utilize proteomics approaches to identify stress-specific changes in SFT2 interactions and modifications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.