Recombinant Saccharomyces cerevisiae Protein transport protein YIF1 (YIF1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for prioritized development.
Synonyms
YIF1; YNL263C; N0820; Protein transport protein YIF1; YIP1-interacting factor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIF1
Target Protein Sequence
MSYNPYAYATSEQNGVNDRFSHTPQQQRPMQIPRNTPVNGQGNANMNANVNGSGGGFPFQ DPRGSMAFQLGQSAFSNFIGQDNFNQFQETVNKATANAAGSQQISTYFQVSTRYVINKLK LILVPFLNGTKNWQRIMDSGNFLPPRDDVNSPDMYMPIMGLVTYILIWNTQQGLKGSFNP EDLYYKLSSTLAFVCLDLLILKLGLYLLIDSKIPSFSLVELLCYVGYKFVPLILAQLLTN VTMPFNLNILIKFYLFIAFGVFLLRSVKFNLLSRSGAEDDDIHVSISKSTVKKCNYFLFV YGFIWQNVLMWLMG
Uniprot No.

Target Background

Function
Essential for the fusion of ER-derived vesicles with the Golgi apparatus during ER-to-Golgi protein transport. It may also play a role in the correct membrane localization of Rab GTPases.
Database Links

KEGG: sce:YNL263C

STRING: 4932.YNL263C

Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Cytoplasmic vesicle, COPII-coated vesicle.

Q&A

What is the fundamental function of Yif1p in Saccharomyces cerevisiae?

Yif1p is an evolutionarily conserved, essential 35.5 kDa transmembrane protein that forms a tight complex with Yip1p on Golgi membranes. The hydrophilic N-terminal half of Yif1p faces the cytosol and can interact with transport GTPases including Ypt1p, Ypt31p, and Sec4p . Loss of Yif1p function in conditional-lethal mutants results in a block of endoplasmic reticulum (ER)-to-Golgi protein transport and in an accumulation of ER membranes and 40-50 nm vesicles . Genetic analyses suggest that Yif1p acts downstream of Yip1p, and Ypt GTPase binding to the Yip1p-Yif1p complex is essential for vesicle docking and fusion processes .

How is Yif1p structurally characterized?

Yif1p belongs to the Yip1 domain family (YIPF) of proteins, which are multi-span transmembrane proteins primarily localized to the Golgi apparatus . The protein contains several conserved motifs that are critical for its function. For instance, the [E-P-P-L-E-E] motif, which is conserved in the YIPFα1 (Yip1p) subfamily, is particularly important . Mutations of specific glutamic acid residues in this motif, such as the E70K mutation in the temperature-sensitive mutant yip1-4, can lead to functional defects including blocked secretion, growth inhibition, and massive proliferation of ER membrane . These structural features are essential for Yif1p's role in the secretory pathway.

What evolutionary relationships exist between yeast Yif1p and its homologs in other organisms?

Yif1p is highly conserved across eukaryotic species, with homologs in organisms ranging from yeasts to mammals. In humans, YIF1B is involved in the anterograde traffic pathway and Golgi architecture . Unlike the yeast protein that primarily resides in the Golgi, human YIF1B belongs to the intermediate compartment (IC) . Despite these differences in localization, functional similarities exist. For example, depletion of YIF1B in human cells accelerates VSVG protein traffic, similar to effects observed in hippocampal neurons from YIF1B knockout mice . This conservation suggests the fundamental importance of YIF1 proteins in cellular trafficking mechanisms across different species.

How do Yif1p and Yip1p cooperate in the secretory pathway?

Yif1p forms a tight complex with Yip1p on Golgi membranes, with both proteins being essential for cellular viability . The Yip1p-Yif1p heteromeric integral membrane complex is required for the fusion competence of transport vesicles . While Yip1p was originally identified as a Ypt1p-interacting protein with affinity for Ypt1 and Ypt31 , Yif1p was subsequently discovered as a Yip1p-interacting factor . Both proteins have cytosolic N-terminal domains that interact with Ypt/Rab GTPases . Genetic analyses suggest that Yif1p acts downstream of Yip1p in the secretory pathway . The coordinated function of these proteins appears critical for vesicle docking and fusion events, though the precise molecular mechanisms remain an area of active investigation.

How might Yif1p contribute to cellular stress responses?

While direct evidence for Yif1p's role in stress responses in yeast is limited, studies of mammalian homologs provide intriguing insights. The human homolog YIPFα1A/Yip1A has been shown to be required for the activation of IRE1 in the unfolded protein response (UPR) . YIPFα1A was shown to be necessary for the oligomerization and activation of IRE1 induced by tunicamycin, a general stress inducer . Furthermore, YIPFα1A is also involved in the activation of PERK, another upstream regulator of the ER stress response that promotes cell survival . These findings suggest that YIF1 family proteins may function as chaperones for transmembrane proteins, facilitating the oligomerization and activation of stress response factors. Whether similar functions exist for yeast Yif1p remains an open question for investigation.

What techniques are most effective for studying Yif1p interactions with binding partners?

Several complementary approaches can be employed to study Yif1p interactions:

TechniqueApplicationAdvantagesLimitations
Yeast Two-Hybrid (Y2H)Initial screening for binary interactionsCan detect direct interactions in vivoMay yield false positives/negatives
Co-immunoprecipitationVerification of physical interactionsWorks in native cellular contextMay not distinguish direct from indirect interactions
Affinity ChromatographyIsolation of protein complexesCan identify multiple interaction partnersRequires optimization for membrane proteins
Microscale ThermophoresisMeasurement of binding affinitiesRequires small sample amountsTechnical challenges with membrane proteins
FRET/BiFCVisualization of interactions in live cellsProvides spatial informationFluorescent tags may interfere with function

What expression systems are optimal for producing recombinant Yif1p for functional studies?

The choice of expression system for recombinant Yif1p production should consider the protein's native environment and requirements for proper folding:

  • Homologous expression in S. cerevisiae: Provides the most native environment for correct folding, membrane insertion, and post-translational modifications. Can be achieved using vectors with inducible promoters (GAL1, CUP1) or constitutive promoters (GPD, TEF).

  • Expression in other yeast species: Pichia pastoris offers advantages for high-density culture and strong induction via the AOX1 promoter.

  • Bacterial expression systems: While E. coli systems may provide high yields, proper folding of this multi-span transmembrane protein can be challenging. Specialized strains with enhanced membrane protein expression capabilities may be beneficial.

  • Mammalian cell expression: Useful when studying interactions with mammalian proteins or when post-translational modifications are critical.

For purification, affinity tags (His, GST, FLAG) can be incorporated, though tag position should be carefully considered to avoid interfering with function. Detergent screening is crucial for extracting this membrane protein while maintaining its native conformation and interaction capabilities.

What are the best approaches for analyzing Yif1p mutant phenotypes?

To comprehensively analyze Yif1p mutant phenotypes, researchers should employ multiple complementary approaches:

  • Growth assays: Conditional-lethal mutants can reveal temperature-sensitive or other stress-dependent phenotypes .

  • Trafficking assays: Monitor transport of well-characterized cargo proteins (e.g., carboxypeptidase Y) to assess ER-to-Golgi transport efficiency.

  • Electron microscopy: Essential for visualizing the accumulation of ER membranes and vesicles that characterize Yif1p dysfunction .

  • Fluorescence microscopy: Using fluorescently tagged Golgi markers to assess Golgi morphology and organization.

  • Biochemical analyses: Examining protein glycosylation patterns to detect defects in ER-to-Golgi transport.

  • Genetic interaction studies: Synthetic genetic array (SGA) analysis can identify genes that interact functionally with YIF1.

When interpreting results, researchers should consider that long-term versus short-term depletion may yield different phenotypes, as observed with YIF1B in mammalian cells where disorganized Golgi architecture was only observed after long-term depletion .

How should researchers approach site-directed mutagenesis of conserved motifs in Yif1p?

When designing mutagenesis studies of Yif1p, researchers should consider:

  • Target selection: Focus on highly conserved residues, particularly within the [E-P-P-L-E-E] motif that has demonstrated functional importance . The glutamic acid residues in this motif are particularly critical, as mutations E70K (in yip1-4) and E76K (in yip1-6) cause temperature sensitivity and lethality, respectively .

  • Mutation strategy: Consider the chemical nature of substitutions. Studies have shown that acidic-to-basic substitutions (E→K) have more severe phenotypes than acidic-to-neutral substitutions (E→G) .

  • Functional validation: Employ complementation assays to determine if mutated versions can rescue the lethal phenotype of YIF1 deletion.

  • Interaction analysis: Test how mutations affect binding to known partners like Yip1p and Ypt GTPases.

  • Localization studies: Determine if mutations alter the subcellular distribution of Yif1p.

A systematic mutagenesis approach examining multiple residues individually and in combination can provide comprehensive insights into structure-function relationships.

What controls are essential when investigating Yif1p-dependent trafficking pathways?

Robust experimental design for studying Yif1p-dependent trafficking should include:

  • Positive controls: Well-characterized cargo proteins with established trafficking kinetics.

  • Negative controls: Cargo that bypasses the Yif1p-dependent pathway or traffics through alternative routes.

  • Rescue experiments: Complementation with wild-type YIF1 to verify phenotype specificity.

  • Temperature controls: Critical for temperature-sensitive mutants, ensuring precise temperature regulation.

  • Time-course analysis: Distinguishing between direct trafficking defects and secondary consequences.

  • Marker validation: Multiple independent markers to confirm compartmental identities.

  • Comparative analysis: Parallel examination of known trafficking mutants (sec mutants) to position Yif1p function within the secretory pathway.

These controls help ensure that observed phenotypes are specifically attributed to Yif1p dysfunction rather than experimental artifacts or indirect effects.

How can researchers address conflicting data regarding Yif1p interactions with GTPases?

When confronting contradictory findings about Yif1p-GTPase interactions:

  • Methodological variations: Different techniques (Y2H, pull-down, co-IP) may yield different results. For example, classical Y2H has been used successfully for some YIPF proteins, but trials with mammalian Rab proteins have been largely unsuccessful .

  • Construct design: The design of bait and prey constructs significantly impacts detection of interactions. Researchers should consider redesigning constructs or using alternative analytical systems when interactions are difficult to detect .

  • Nucleotide dependence: GTPase interactions often depend on their nucleotide-bound state. Testing interactions with GDP-bound, GTP-bound, and nucleotide-free forms is essential .

  • Species differences: Interactions documented in yeast may not directly translate to mammalian systems, as suggested by the difficulty in detecting interactions between mammalian YIPF proteins and Rab proteins despite their established interactions in yeast .

  • Quantitative approach: Using techniques like microscale thermophoresis (MST) to measure binding affinities can provide more nuanced understanding than binary (yes/no) interaction assays .

How should differences between yeast Yif1p and mammalian YIF1B phenotypes be interpreted?

When comparing phenotypes across species:

  • Functional convergence vs. divergence: While both yeast Yif1p and mammalian YIF1B function in vesicular trafficking, their specific roles may have diverged. For instance, YIF1B depletion in mammalian cells accelerates VSVG protein traffic , whereas loss of Yif1p in yeast blocks ER-to-Golgi transport .

  • Localization differences: Yeast Yif1p primarily localizes to Golgi membranes , while mammalian YIF1B belongs to the intermediate compartment (IC) . These localization differences may reflect evolutionary adaptations to the more complex trafficking systems in higher eukaryotes.

  • Temporal considerations: Short-term versus long-term depletion may reveal different aspects of function. In mammalian cells, long-term YIF1B depletion leads to disorganized Golgi architecture, while short-term depletion affects trafficking without structural changes .

  • Functional redundancy: The presence of multiple related proteins in mammalian systems may provide redundancy not present in yeast, potentially masking certain phenotypes.

  • Experimental systems: Differences in cell types (dividing vs. non-dividing) and experimental approaches must be considered when comparing across studies.

What bioinformatic approaches can enhance understanding of Yif1p function?

Computational analyses can provide valuable insights into Yif1p:

ApproachApplicationExpected Outcome
Sequence alignmentIdentify conserved motifs across speciesFunctionally critical residues
Transmembrane topology predictionDefine membrane integration patternStructural insights
Protein-protein interaction networksMap functional relationshipsPathway connections
Structural modelingPredict three-dimensional organizationMechanistic hypotheses
Co-evolution analysisIdentify functionally linked residuesInteraction surfaces
Gene expression correlationFind co-regulated genesFunctional associations

These computational approaches should be combined with experimental validation to develop comprehensive models of Yif1p function within the cellular trafficking machinery.

How can systems biology approaches integrate Yif1p function into broader cellular networks?

To place Yif1p in its broader cellular context:

  • Interactome analysis: Comprehensive identification of physical interaction partners through mass spectrometry-based proteomics.

  • Transcriptomic profiling: RNA-seq analysis of gene expression changes in YIF1 mutants or depleted cells to identify downstream effectors and compensatory responses.

  • Genetic interaction mapping: Systematic genetic interaction screens (e.g., SGA) to identify genes that buffer or enhance YIF1 phenotypes.

  • Metabolomic analysis: Assessment of metabolic consequences of disrupted trafficking.

  • Network modeling: Integration of multiple data types to construct predictive models of how Yif1p interfaces with various cellular systems.

  • Comparative genomics: Analysis of YIF1 across species to identify evolutionary patterns in function and interaction partners.

By integrating multiple approaches, researchers can develop a comprehensive understanding of how Yif1p functions within the complex landscape of cellular trafficking and homeostasis.

What are the most promising approaches for resolving the molecular mechanism of Yif1p in vesicular transport?

To elucidate Yif1p's precise molecular mechanism:

  • Structural studies: Cryo-electron microscopy of the Yip1p-Yif1p complex, potentially in association with Ypt GTPases, would provide critical insights into interaction surfaces and conformational changes.

  • Single-molecule approaches: Techniques like single-molecule FRET could reveal dynamic conformational changes during the transport cycle.

  • In vitro reconstitution: Purified components in liposome-based assays could establish minimal requirements for Yif1p-mediated processes.

  • Super-resolution microscopy: Techniques like STORM or PALM could visualize Yif1p dynamics at vesicle budding and fusion sites with unprecedented resolution.

  • Targeted mutagenesis: Comprehensive alanine-scanning mutagenesis could map functional surfaces with precision.

These approaches would help resolve longstanding questions about how Yif1p contributes to vesicle formation, trafficking, and fusion at the molecular level.

What unknown aspects of Yif1p function warrant investigation?

Several aspects of Yif1p biology remain poorly understood:

  • Regulation: How is Yif1p activity regulated in response to cellular conditions? Are post-translational modifications involved?

  • Cargo specificity: Does Yif1p exhibit preferences for specific cargo types, or is it a general component of the trafficking machinery?

  • Membrane remodeling: Does Yif1p play a direct role in membrane curvature or remodeling during vesicle formation?

  • Stress responses: Given the role of mammalian homologs in stress responses , does yeast Yif1p have similar functions in cellular adaptation to stress?

  • Cell-cycle dependence: Is Yif1p function modulated during different phases of the cell cycle?

  • Interaction with cytoskeleton: Does Yif1p interface with cytoskeletal elements that facilitate vesicle movement?

Addressing these questions would significantly advance our understanding of this essential protein's full functional repertoire.

How might Yif1p research inform broader questions in eukaryotic cell biology?

Yif1p research has implications beyond trafficking:

  • Evolutionary cell biology: Comparing Yif1p function across diverse eukaryotes can illuminate the evolution of trafficking systems.

  • Organelle biogenesis: Understanding how Yif1p contributes to maintaining Golgi structure in mammals may provide insights into organelle biogenesis and homeostasis.

  • Disease mechanisms: Given connections between mammalian YIF1 proteins and stress responses , this research may inform understanding of diseases involving ER stress.

  • Synthetic biology: Knowledge of Yif1p function could enable engineering of modified trafficking pathways for biotechnological applications.

  • Drug development: As an essential component of cellular trafficking, Yif1p pathways represent potential targets for antifungal development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.