Recombinant Saccharomyces cerevisiae Protein transport protein YIP1 (YIP1)

Shipped with Ice Packs
In Stock

Description

Protein Architecture and Conservation

YIP1 is a founding member of the YIPF protein family and consists of 248 amino acids in Saccharomyces cerevisiae . Bioinformatic analyses and experimental evidence indicate that YIP1 possesses a conserved transmembrane domain arrangement, now annotated as the "Yip1 domain" in the Conserved Domain Database (CDD) . This domain represents the most highly conserved region of YIP1 proteins across species, highlighting its functional significance. The YIP1 protein is predicted to have an odd number of transmembrane segments, most likely five, with an N-terminal cytoplasmic region and a short C-terminal portion exposed to the lumen of the Golgi apparatus . This topology appears optimized for its role in membrane trafficking processes.

Transmembrane Topology

The transmembrane organization of YIP1 is characterized by multiple hydrophobic segments that anchor the protein within the membrane bilayer . These segments are well-conserved across different YIPF proteins, while the N- and C-terminal regions demonstrate less sequence conservation . The high number of transmembrane segments suggests that YIP1 and related YIPF complexes may function as channels, transporters, or transmembrane receptors . The amino acid sequence of full-length YIP1 includes significant regions of hydrophobic residues consistent with its role as an integral membrane protein .

Essential Role in Vesicular Transport

YIP1 is encoded by an essential gene in Saccharomyces cerevisiae, and temperature-sensitive mutations in this gene result in severe disruption of membrane transport . Specifically, defective YIP1 alleles inhibit ER vesicle budding, suggesting a critical role in the initial stages of vesicular transport . This function is particularly interesting given the connection to Rab proteins, as some transport steps can still occur in the absence of specific Rab functions. For instance, fusion-competent transport vesicles can form from the ER without Ypt1p function, which is the Rab protein thought to regulate this transport step in vivo .

YIP1 Protein Complexes

YIP1 forms functional complexes with other proteins to execute its role in vesicular trafficking. Notably, YIP1 interacts with YIF1, another member of the YIPF family, to form a complex essential for ER to Golgi transport . This YIP1-YIF1 complex binds to Ypt1p and Ypt31p, suggesting a cooperative function in vesicular transport . Additionally, YIP1 has paralogs in S. cerevisiae, including YIP4p and YIP5p, which also interact with Ypt/Rab GTPases but have distinct, non-overlapping functions . Interactome analyses demonstrate that YIPF proteins (YIP1p, YIF1p, YIP4p, YIP5p) form a core physical interaction network with selections of Ypt/Rab GTPases that connects with other proteins functioning in membrane trafficking, including SNAREs and COPII components .

Yeast-Based Expression Strategies

While specific information about YIP1 expression in yeast systems is limited in the provided search results, S. cerevisiae has been extensively utilized as a host for recombinant protein production . This yeast offers advantages including natural adaptability to harsh industrial-scale conditions and the ability to correctly produce and secrete biologically active eukaryotic proteins . For membrane proteins like YIP1, yeast expression systems might provide a more native environment for proper folding and function compared to bacterial systems.

Vector Systems for Recombinant Expression

For the production of recombinant proteins in S. cerevisiae, three types of vectors are commonly employed: integration plasmids (YIp), episomal plasmids (YEp), and centromeric plasmids (YCp) . YEp plasmids, based on the endogenous 2μ origin of replication, are maintained in high copy numbers (5-30 copies) inside the cell, enabling robust gene expression but potentially imposing a substantial burden on cells, resulting in increased plasmid instability . YCp plasmids, based on a combination of autonomously replicating sequence (ARS) and yeast centromeric sequence (CEN), are maintained in low copy numbers (1-2 copies) and offer greater stability but lower gene expression levels . Integration of an expression cassette into a target locus on a native yeast chromosome is beneficial as it allows for the removal of selective pressure after the recombinant strain is constructed .

Promoter Systems for YIP1 Expression

The choice of promoter significantly impacts the expression levels of recombinant proteins. In S. cerevisiae, several constitutive promoters are available for recombinant protein expression, including ADH1, GAPDH, PGK1, TPI, ENO, PYK1, and TEF . Additionally, inducible promoters such as GAL1-10, CUP1, and ADH2 can be utilized for controlled expression . The table below summarizes commonly used promoters for recombinant protein expression in various yeast species:

HostConstitutive PromotersInducible Promoters
S. cerevisiaeADH1, GAPDH, PGK1, TPI, ENO, PYK1, TEFGAL1-10, CUP1, ADH2
K. lactisPGKLAC4, ADH4
Y. lipolyticaTEF, RPS7, XPR2/hp4dPOX2, POT1, ICL1
K. phaffiiGAP, TEF, PGK, YPT1AOX1, FLD1, PEX8

This diversity of promoters allows for tailored expression strategies depending on the specific requirements for recombinant YIP1 production .

Physiological Requirements for YIP1 Action

Genetic studies have provided insights into the physiological requirements for YIP1 function. YIP1 function requires Rab-GDI and Rab proteins, and several mutations that abrogate YIP1 function lack Rab-interacting capability . This suggests that the interaction with Rab proteins is essential for YIP1's role in vesicular transport. Interestingly, while YIP1 can physically interact with multiple Rab proteins in detergent extracts, genetic analysis covering every yeast Rab reveals that the Rab requirement in vivo is exclusively confined to a subset of Rab proteins localized to the Golgi apparatus .

Evolutionary Conservation of YIP1

YIP1 is extremely well conserved throughout evolution, underscoring its fundamental role in eukaryotic cellular processes . The human ortholog of YIP1 can fully replace the loss of the yeast gene, demonstrating the conservation of function across species separated by over a billion years of evolution . This high degree of conservation suggests that the mechanisms by which YIP1 functions in vesicular transport are fundamental to eukaryotic cells and have been maintained throughout evolutionary history.

Interaction with Other Trafficking Components

YIP1 functions within a complex network of proteins involved in membrane trafficking. Genetic and physical interaction studies have identified connections between YIP1 and other components of the trafficking machinery . For instance, YIP1 genetically interacts with GOT1, a tetra-spanning small membrane protein predicted to function in ER to Golgi transport at the vesicle budding step . GOT1 was identified as a multicopy suppressor of a temperature-sensitive YIP1 mutant (yip1-2), suggesting functional overlap or compensation between these proteins .

Role in Vesicle Formation

The exact role of YIP1 in vesicle formation remains partially understood. In vitro reconstitution studies combined with cell biological and genetic analyses have demonstrated that YIP1 functions at an early stage in ER vesicle budding . This function is somewhat difficult to reconcile with its connection to Rab proteins, as Rab proteins are typically associated with later stages of vesicular transport such as tethering and fusion . The dual role of YIP1 in both early vesicle formation and interaction with Rab proteins suggests a complex and potentially regulatory function in coordinating different stages of vesicular transport.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery estimates, please consult your local distributor.
Note: Our standard shipping procedure includes regular blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
YIP1; YGR172C; Protein transport protein YIP1; YPT-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIP1
Target Protein Sequence
MSFYNTSNNANNGGGFYQPSAQFAVPQGSMSFQNTVGSSNTGNDNNLGVAPDPLPVGILH ALSTKGYPHEPPLLEEIGINFDHIITKTKMVLIPIRFGSGVPQEILNDSDLAGPLIFFLL FGLFLLMAGKVHFGYIYGVALFGTISLHNLSKLMSNNDTSTQTNLQFFNTASILGYCFLP LCFLSLLGIFHGLNNTTGYVVSVLFVIWSTWTSSGFLNSLLQLQNARLLIAYPLLIFYSV FALMVIFV
Uniprot No.

Target Background

Function
YIP1 is essential for fusion of ER-derived vesicles with the Golgi during ER-to-Golgi protein transport. It likely facilitates this process by mediating the correct membrane localization of YPT1.
Gene References Into Functions
  1. This study identifies Yip1A as a crucial prosurvival modulator that coordinates IRE1 and PERK signaling to support the survival of HeLa and CaSki cervical cancer cells. PMID: 28358375
  2. Rab requirement is specific to a subset of Rab proteins localized to the Golgi apparatus. PMID: 15611160
  3. Yos1p interacts with Yip1p and Yif1p, suggesting that Yos1p is a novel component of the Yip1p-Yif1p complex. PMID: 15659647
Database Links

KEGG: sce:YGR172C

STRING: 4932.YGR172C

Protein Families
YIP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is YIP1 and where is it localized in Saccharomyces cerevisiae?

YIP1 is a 248 amino acid integral membrane protein (27.07 kDa) primarily localized to the Golgi apparatus in Saccharomyces cerevisiae. It contains approximately five transmembrane segments with an N-terminal cytoplasmic region and a short C-terminal region exposed to the lumen of the Golgi apparatus. The protein has three well-defined putative membrane-spanning domains, and its transmembrane regions are composed of multiple hydrophobic segments that are well conserved across species, while the N- and C-terminal regions show less conservation . YIP1 is the founding member of the YIP1 domain family (YIPF) proteins which are found in virtually all eukaryotes, suggesting evolutionarily conserved essential functions .

Is YIP1 essential for cell viability in yeast?

Yes, YIP1 is essential for cell growth and proliferation in Saccharomyces cerevisiae. Genetic studies involving YIP1 gene disruption have demonstrated that deletion of the gene is lethal. In experiments where one YIP1 gene was knocked out in a diploid strain by deleting a 575 bp fragment including codons 1-190 and replacing it with a URA3 marker gene, tetrad analysis showed that although all four spores could germinate, only the two spores containing wild-type YIP1 formed colonies . This conclusively demonstrates that YIP1 is essential for cell viability in yeast.

What is the evolutionary conservation of YIP1 across species?

YIP1 is highly conserved across eukaryotic species, from yeast to humans. The human homolog of YIP1 can fully complement the essential function of yeast YIP1, indicating that the critical functions of this protein have been maintained throughout evolution . Specifically, the transmembrane region, now annotated as the "Yip1 domain" in the Conserved Domain Database (CDD), shows remarkable conservation, while the N- and C-terminal regions are less conserved . This conservation pattern suggests that the membrane-embedded portions of the protein are crucial for its function in the secretory pathway.

What are the known binding partners of YIP1 and how were they identified?

YIP1 was initially discovered to specifically interact with Ypt1p and Ypt31p, which are homologs of mammalian Rab1 and Rab11 respectively. These interactions were first identified using yeast two-hybrid screens where YIP1 was found as a binding partner for both wild-type GTPases . The specificity of these interactions was demonstrated by the absence of binding to other Ypt GTPases such as Ypt6p and Ypt7p in the two-hybrid system .

The protein interactions were further validated using biochemical approaches. In pull-down experiments, a GST fusion protein containing the hydrophilic N-terminal domain of YIP1 (amino acid residues 1-99) efficiently bound Ypt31p and, to a lesser extent, Ypt1p from yeast cell lysates. Consistently, two-hybrid analysis showed that the N-terminal domain of YIP1 bound efficiently to Ypt31p but not Ypt1p, while the complete YIP1 protein interacted similarly well with both GTPases . These results suggest that different regions of YIP1 might be involved in binding different Ypt GTPases.

What is the proposed role of YIP1 in vesicular transport?

YIP1 is proposed to play critical roles in ER-to-Golgi and intra-Golgi transport through its interactions with Ypt/Rab GTPases. Temperature-sensitive YIP1 mutants show significant delays in ER-to-Golgi transport, with accumulation of ER core-glycosylated forms of proteins like carboxypeptidase Y (CPY) and invertase . Additionally, these mutants secrete hypoglycosylated invertase, suggesting a general disturbance in Golgi function that might result from failure to properly deliver or distribute enzymes such as glycosyltransferases between different Golgi compartments .

YIP1 forms a complex with another protein, Yif1p, and this complex is proposed to bind Ypt1p and Ypt31p to play essential roles in vesicular transport . The precise mechanism remains unclear, but YIP1 may function in vesicle biogenesis and/or mediate the association of Rab proteins with membranes . The fact that YIP1 interacts with GTPases functioning at consecutive stages of the biosynthetic pathway (ER-to-Golgi and intra-Golgi) suggests it may coordinate transport between these compartments.

Does YIP1 interact with the GDP or GTP-bound form of Ypt GTPases?

It was proposed that YIP1 preferentially binds the GDP-bound form of Ypt1p or Ypt31p because YIP1 did not show yeast two-hybrid interaction with GTPase-deficient mutants of these proteins . GTPase-deficient mutants are typically locked in the GTP-bound state, suggesting that YIP1 may not bind efficiently to the active form of these GTPases. This preference for GDP-bound forms would fit with a model where YIP1 functions in the recruitment or activation cycle of Ypt/Rab GTPases at membranes.

What are the recommended approaches for studying YIP1 membrane topology?

To study YIP1 membrane topology, researchers should employ a combination of biochemical and cell biological approaches:

  • Membrane extraction assays: Treat isolated membranes containing YIP1 with different reagents to determine protein association with membranes:

    • 1% Triton X-100 (detergent solubilization)

    • 5M urea (disrupts protein-protein interactions)

    • 0.1M sodium carbonate, pH 11 (releases peripheral membrane proteins)

    • 1M NaCl or 1M KOAc (disrupts ionic interactions)

    After treatment, separate soluble and membrane fractions by ultracentrifugation (100,000 × g) and analyze the distribution of YIP1 by immunoblotting .

  • Protease protection assays: Treat intact or permeabilized organelles containing YIP1 with proteases (e.g., proteinase K) and identify protected fragments by immunoblotting with antibodies against different regions of YIP1. This helps determine which domains are exposed to the cytosol versus the lumen.

  • Fluorescence microscopy with domain-specific tags: Generate YIP1 constructs with fluorescent tags or epitope tags at different positions and determine their accessibility in intact versus permeabilized cells to validate the predicted topology.

  • Glycosylation site mapping: Introduce artificial N-glycosylation sites in different regions of YIP1 and assess their glycosylation status, which occurs only in the lumen of the secretory pathway.

These approaches can collectively provide a comprehensive view of YIP1's membrane orientation and topology.

How can conditional YIP1 mutants be generated for functional studies?

Two main strategies have been successfully employed to generate conditional YIP1 mutants for functional studies:

  • PCR mutagenesis to create temperature-sensitive alleles:

    • Perform error-prone PCR amplification of the YIP1 coding sequence

    • Clone the mutagenized PCR products into appropriate yeast expression vectors

    • Transform into a yeast strain with YIP1 deletion covered by a URA3-marked YIP1 plasmid

    • Screen transformants for temperature-sensitive growth by replica plating at permissive (25°C) and non-permissive (37°C) temperatures after counter-selection on 5-FOA medium

    • Sequence mutants to identify causative amino acid substitutions

  • Regulatable promoter replacement:

    • Place YIP1 under transcriptional control of the regulatable GAL10 promoter through homologous recombination

    • This allows for depletion of YIP1 by shifting cells from galactose-containing medium (expression ON) to glucose-containing medium (expression OFF)

    • Monitor YIP1 depletion by Western blotting and correlate with phenotypic effects

Both approaches have been successfully used for YIP1 functional characterization . Temperature-sensitive mutants offer the advantage of rapid inactivation upon temperature shift, while promoter-regulated expression allows for more gradual depletion which may reveal earlier defects in YIP1 function.

What are the appropriate subcellular fractionation techniques for isolating YIP1-containing compartments?

To isolate and characterize YIP1-containing compartments, the following subcellular fractionation approach is recommended:

  • Initial differential centrifugation:

    • Prepare cell lysates in appropriate buffer (e.g., 50 mM Tris pH 7.5, 100 mM KCl, 1 mM EDTA, 1 mM DTT, with protease inhibitors)

    • Remove cell debris by centrifugation at 500 × g for 5 minutes

    • Centrifuge the cleared lysate at 10,000 × g for 15 minutes to obtain the P10 pellet (containing larger organelles)

    • Further centrifuge the S10 supernatant at 100,000 × g for 1 hour to obtain P100 (microsomal fraction) and S100 (cytosolic fraction)

  • Sucrose density gradient centrifugation:

    • Layer the cleared lysate onto a sucrose density gradient (e.g., 20-60% sucrose)

    • Centrifuge at high speed (e.g., 100,000 × g) for several hours

    • Collect fractions and analyze by immunoblotting for YIP1 and markers of different organelles (e.g., Sec61p for ER, Emp47p for Golgi)

  • Immunoisolation of YIP1-containing vesicles:

    • Prepare antibodies against YIP1 or use epitope-tagged versions

    • Couple antibodies to magnetic beads or other solid supports

    • Incubate with P100 microsomal fractions

    • Wash and elute bound vesicles for biochemical or morphological analysis

These techniques allow for separation of YIP1-containing compartments from other cellular organelles and provide material for further biochemical and functional characterization.

How does the YIP1-Yif1p complex contribute to vesicle biogenesis?

The YIP1-Yif1p complex is proposed to function in vesicle biogenesis at the ER-Golgi interface, though the precise mechanism remains incompletely understood. Current evidence suggests several potential roles:

  • Recruitment of coat proteins: The YIP1-Yif1p complex may facilitate the recruitment of coat proteins necessary for vesicle budding. This hypothesis is supported by genetic interactions between YIP1 and components of the vesicle budding machinery.

  • Regulation of Ypt/Rab GTPase function: By binding to Ypt1p and Ypt31p, the YIP1-Yif1p complex may help recruit these GTPases to specific membrane domains where vesicle formation occurs. This may establish a local environment conducive to vesicle budding.

  • Membrane remodeling: The multispanning transmembrane nature of both YIP1 and Yif1p suggests they might directly participate in membrane curvature changes required for vesicle formation.

  • Coordination with GOT1: YIP1 genetically interacts with GOT1, a tetra-spanning small membrane protein predicted to function in ER to Golgi transport at the vesicle budding step. GOT1 was identified as a multicopy suppressor of a temperature-sensitive YIP1 mutant (yip1-2) . Although Got1p and Yip1p do not form a stable complex, their genetic interaction suggests they function in parallel or overlapping pathways in vesicle formation.

To fully elucidate the role of the YIP1-Yif1p complex in vesicle biogenesis, future studies should focus on reconstituting vesicle formation in vitro with purified components and developing advanced imaging techniques to visualize the early stages of vesicle budding in living cells.

What are the functional differences between YIP1 family members in yeast and mammals?

The YIP1 domain family has expanded in mammals compared to yeast, suggesting functional diversification. Key differences include:

  • Number and specialization of family members:

    • S. cerevisiae contains four YIPFs: Yip1p, Yif1p, Yip4p, and Yip5p

    • Mammals have at least 9 YIPF proteins, divided into two subfamilies (YIPFα and YIPFβ)

    • This expansion suggests more specialized roles for individual family members in mammals

  • Rab GTPase interactions:

    • Yeast Yip1p interacts with Ypt1p and Ypt31p (Rab1 and Rab11 homologs)

    • Direct evidence for interactions between mammalian YIPF proteins and Rab GTPases is currently lacking, despite attempts to detect such interactions using yeast two-hybrid analysis and pull-down assays

  • Additional functions in mammals:

    • Mammalian YIPFα1A/Yip1A is involved in stress-induced IRE1 activation in the endoplasmic reticulum

    • YIPFα1A is required for the activation of IRE1 following Brucella-containing vacuole formation and Brucella replication

    • YIPFα1A is involved in cancer cell survival through activation of IRE1 and PERK, which are upstream regulators of the ER stress response

    • YIPFα1A may function as a chaperone for transmembrane proteins, promoting oligomerization and activation of stress sensors like IRE1 and PERK

These differences highlight the evolutionary diversification of YIPF protein functions, with mammalian homologs potentially acquiring roles beyond membrane trafficking that relate to stress responses and cell survival.

How does YIP1 coordinate with other proteins to regulate membrane dynamics?

YIP1 coordinates with multiple protein partners to regulate membrane dynamics in the early secretory pathway:

  • YIP1-Yif1p complex formation:

    • YIP1 forms a complex with Yif1p, another essential protein

    • This complex interacts with Ypt1p and Ypt31p GTPases

    • The formation of this complex is likely a prerequisite for proper function in vesicular transport

  • Genetic interactions with GOT1:

    • GOT1 was identified as a multicopy suppressor of a temperature-sensitive YIP1 mutant

    • Got1p cycles between the ER and Golgi apparatus

    • Overexpression of Got1p causes complex extension of the ER membrane and disruption of the Golgi apparatus

    • This genetic interaction suggests that Got1p and Yip1p may function in parallel pathways that influence membrane dynamics at the ER-Golgi interface

  • Potential interaction with lipid-modifying enzymes:

    • The function of YIP1 may be linked to the regulation of membrane lipid composition

    • Changes in membrane lipids can influence membrane curvature and vesicle formation

    • Research on possible connections between YIP1 and lipid-modifying enzymes could reveal important mechanisms in membrane trafficking

  • Coordination with vesicle coat proteins:

    • YIP1 function may be linked to the recruitment or activity of coat proteins like COPII at the ER or COPI at the Golgi

    • Defects in YIP1 function lead to disruptions in vesicular transport, suggesting a role in facilitating proper coat assembly or function

Understanding these coordinated interactions will require integrative approaches combining genetic, biochemical, and advanced imaging techniques to capture the dynamic nature of these processes in living cells.

What are common challenges in purifying recombinant YIP1 and how can they be overcome?

Purifying recombinant YIP1 presents several challenges due to its multiple transmembrane domains. Here are common issues and recommended solutions:

ChallengeSolution
Poor expression levelsUse specialized expression systems like Pichia pastoris or insect cells that handle membrane proteins better than E. coli
Protein aggregationInclude stabilizing detergents (DDM, LMNG, or CHAPS) in all buffers; consider fusion tags that enhance solubility (MBP, SUMO)
Difficulty in extraction from membranesOptimize detergent type and concentration; try detergent mixtures; include lipids for stabilization
Loss of function upon purificationConsider purifying protein complexes (e.g., YIP1-Yif1p) rather than individual components
Protein instabilityMaintain strict temperature control during purification (4°C); include glycerol (10-20%) and reducing agents
Difficulty in removing tagsDesign constructs with multiple purification options; use TEV protease which works efficiently in detergent solutions

For functional studies, consider expressing and purifying the N-terminal cytosolic domain separately, which has been shown to retain Ypt/Rab binding activity. This approach simplifies purification while still allowing investigation of key protein-protein interactions .

How can researchers distinguish between direct and indirect effects of YIP1 dysfunction?

Distinguishing between direct and indirect effects of YIP1 dysfunction requires a multi-faceted approach:

  • Temporal analysis after YIP1 inactivation:

    • Use rapidly acting conditional systems (temperature-sensitive mutants or auxin-inducible degron tags)

    • Monitor cellular changes at multiple timepoints after YIP1 inactivation

    • Early effects (within minutes to 1-2 hours) are more likely to be direct consequences

  • Structure-function analysis:

    • Generate a panel of YIP1 mutants with specific defects in different domains

    • Correlate specific mutations with distinct cellular phenotypes

    • Mutations affecting known binding interfaces should disrupt direct functions

  • Suppressor screening:

    • Identify genetic suppressors of YIP1 mutants

    • Suppressors often function in the same pathway or process

    • This approach can reveal functional relationships not apparent from biochemical studies

  • In vitro reconstitution:

    • Reconstitute specific activities with purified components

    • Functions that can be reconstituted with purified YIP1 are likely direct effects

    • Compare requirements for YIP1 in different reconstituted processes

  • Acute protein depletion vs. chronic absence:

    • Compare effects of acute depletion (e.g., using anchor-away techniques) with chronic absence

    • Secondary effects often become more pronounced with chronic absence

By combining these approaches, researchers can build a comprehensive understanding of which cellular processes are directly dependent on YIP1 function.

What controls and validations are essential when analyzing YIP1 protein-protein interactions?

When analyzing YIP1 protein-protein interactions, the following controls and validations are essential:

  • Multiple detection methods:

    • Confirm interactions using at least two independent techniques (e.g., yeast two-hybrid, co-immunoprecipitation, FRET, proximity ligation)

    • Each method has limitations and can produce false positives or negatives

  • Domain mapping:

    • Determine which domains/regions of both proteins are necessary for the interaction

    • This helps distinguish specific from non-specific interactions

    • For YIP1, the N-terminal domain has been shown to be important for Ypt31p binding

  • Mutational analysis:

    • Test the effects of point mutations on interaction strength

    • Mutations that specifically disrupt interactions without affecting protein folding are valuable for functional studies

    • For YIP1-GTPase interactions, test both wild-type and nucleotide-locked mutants of the GTPase partners

  • Competition assays:

    • Test whether excess of one binding partner can compete with another

    • Helps determine whether binding sites overlap or are distinct

    • Particularly important when studying interactions with multiple Ypt/Rab GTPases

  • Controls for technical artifacts:

    • Include non-binding protein controls (e.g., cytosolic proteins when studying membrane protein interactions)

    • For tagged proteins, ensure tags themselves don't mediate interactions

    • For yeast two-hybrid, test for auto-activation by each construct alone

  • Reciprocal co-immunoprecipitation:

    • Perform co-IPs in both directions (i.e., immunoprecipitate each protein and check for co-precipitation of the other)

    • This strengthens evidence for a genuine interaction

  • Subcellular co-localization:

    • Verify that interacting proteins occupy the same subcellular compartments

    • Use high-resolution microscopy (confocal, STORM, STED) to confirm co-localization

Rigorous application of these controls and validations will provide confidence in the specificity and biological relevance of YIP1 protein-protein interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.