Recombinant Saccharomyces cerevisiae Protein YIP5 (YIP5)

Shipped with Ice Packs
In Stock

Description

Protein Overview

YIP5 (UniProtKB: P53108) belongs to the YIP1 family of proteins and is essential for ER-to-Golgi transport in Saccharomyces cerevisiae. It localizes to the Golgi, ER, and COPII vesicles, facilitating vesicle biogenesis and cargo trafficking .

Functional Roles

  • Vesicle-Mediated Transport: YIP5 interacts with Rab GTPases (e.g., Ypt1p) and other YIP family members (YIP1, YIP4) to regulate COPII vesicle formation and fusion .

  • Membrane Protein Biogenesis: Required for the structural integrity of transport vesicles, ensuring proper segregation of cargo proteins during ER export .

Protein Interactions

YIP5 forms a network with key trafficking proteins, as evidenced by STRING database analysis :

Interacting ProteinFunctionInteraction Score
YIP4Vesicle transport; late Golgi localization0.995
YIP1COPII vesicle biogenesis; interacts with Yif1p and Yos1p0.973
TVP23Late Golgi vesicle localization0.935
YPT1 (Rab GTPase)ER-to-Golgi trafficking; regulates secretory pathway0.600

These interactions highlight YIP5’s central role in coordinating vesicle dynamics .

Key Findings

  • Stabilization of Trafficking Machinery: YIP5 collaborates with YIP1 and Yif1p to maintain vesicle fusion efficiency .

  • Genetic Interactions: YIP5 deletion mutants exhibit synthetic lethality with rad1 rad52 alleles, linking vesicle transport to DNA repair pathways .

Future Directions

Further studies could explore:

  • Recombinant YIP5 purification and structural analysis.

  • Functional assays using COPII vesicle reconstitution systems.

  • Cross-species complementation studies with human YIPF5 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference when placing the order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery time estimates, please consult your local distributor.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please contact us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YIP5; YGL161C; G1832; Protein YIP5; YPT-interacting protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YIP5
Target Protein Sequence
MPSNNSSFLDIDDDLEGVDDFGNEPNPFDDATVPDSPNMNNSTAGKGSEFYNTTGSKAES APLQGQMDPPAYDQVIGQNDNDGLGRNGLRPGLINYYSKYFQIDLTQFKKRLSAVLTFRN DHNSESNEDNTDLYGAVWITATVVMINFTMSRGLNFIISDVIEGVKTGEDIDRASQFKKL LHSIWLFYGYTFGVPFITMQVLNRDEHSERNRSFKSVPELISVYGYANLIWIPVCVILNI LDMSKRLRTVQAIQWAIVALGWAQSSYFLNSQISSNNNTETQSNGKFSLSIIVVVALHTL FCLLFRFIIF
Uniprot No.

Target Background

Function
Possible role in vesicle-mediated transport. May be involved in the proper membrane localization of Rab GTPases.
Database Links

KEGG: sce:YGL161C

STRING: 4932.YGL161C

Protein Families
YIP1 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How can YIP5 be effectively expressed in recombinant systems?

For recombinant expression of YIP5, E. coli systems have been successfully employed with N-terminal His-tagging strategies . The methodological approach involves:

  • Gene synthesis or PCR amplification of the YIP5 coding sequence

  • Cloning into an appropriate expression vector containing an N-terminal His-tag

  • Transformation into competent E. coli cells

  • Expression optimization (temperature, IPTG concentration, incubation time)

  • Purification via nickel affinity chromatography

For optimal results, researchers should test multiple E. coli strains (BL21(DE3), Rosetta, Arctic Express) as expression hosts. Expression conditions should be optimized by testing induction at different OD600 values (0.6-0.8) and varying IPTG concentrations (0.1-1.0 mM) to maximize protein yield while minimizing inclusion body formation.

What purification challenges might researchers encounter with YIP5?

When purifying recombinant YIP5, researchers should anticipate several challenges:

  • Potential for inclusion body formation requiring refolding protocols

  • Optimization of buffer conditions to maintain protein stability

  • Non-specific binding during affinity chromatography

A methodological approach to address these challenges includes:

  • Initial small-scale expression tests to determine solubility

  • Buffer optimization with varying pH (6.5-8.5) and salt concentrations (100-500 mM NaCl)

  • Addition of stabilizing agents such as glycerol (5-10%) or specific detergents if membrane association is suspected

  • Implementation of a multi-step purification strategy combining affinity chromatography with size exclusion or ion exchange methods

How might YIP5 interact with ubiquitination pathways in yeast?

While direct evidence for YIP5 involvement in ubiquitination pathways is not explicitly demonstrated in the available research, the ubiquitin-protein ligase Rsp5 plays significant roles in yeast protein regulation. Researchers investigating potential connections should consider:

  • Conducting co-immunoprecipitation experiments with YIP5 and Rsp5

  • Examining YIP5 for PY motifs (PPxY or LPxY) that might facilitate Rsp5 interaction

  • Performing ubiquitination assays with recombinant YIP5 and Rsp5

What experimental approaches are optimal for studying YIP5 localization?

To determine the subcellular localization of YIP5, researchers should employ multiple complementary techniques:

  • Fluorescent protein fusion constructs (GFP-YIP5, YIP5-GFP)

  • Immunofluorescence microscopy using anti-YIP5 antibodies

  • Cell fractionation followed by Western blot analysis

  • Co-localization studies with known organelle markers

The methodological approach should include:

  • Construction of C- and N-terminal GFP fusion proteins to account for potential interference with localization signals

  • Transformation into yeast strains using standard protocols

  • Visualization under various growth conditions and stresses

  • Quantitative analysis of co-localization with organelle markers

How can researchers design experiments to determine YIP5 function in vivo?

Determining the biological function of YIP5 requires a systematic approach:

  • Gene deletion/knockout studies using CRISPR-Cas9 or traditional homologous recombination

  • Phenotypic analysis of YIP5 deletion mutants under various conditions

  • Complementation studies with wild-type and mutant YIP5 variants

  • Synthetic genetic array (SGA) analysis to identify genetic interactions

The experimental design should include:

  • Construction of YIP5 deletion strains in diverse genetic backgrounds

  • Phenotypic screening under various stress conditions (temperature, oxidative stress, nutrient limitations)

  • Transcriptomic and proteomic analysis of deletion strains

  • Complementation studies to confirm phenotypes are specific to YIP5 loss

What protein-protein interaction methods are most suitable for identifying YIP5 binding partners?

To identify YIP5 binding partners, researchers should employ multiple complementary approaches:

  • Yeast two-hybrid screening

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity-dependent biotin identification (BioID)

  • Protein microarray screening

For co-immunoprecipitation approaches, researchers should:

  • Use both N- and C-terminal tagged versions of YIP5

  • Perform crosslinking studies to capture transient interactions

  • Include appropriate controls for non-specific binding

  • Apply stringent washing conditions with validation of results using reciprocal pulldowns

How can researchers analyze post-translational modifications of YIP5?

Analysis of post-translational modifications (PTMs) of YIP5 requires:

  • Mass spectrometry-based approaches

    • Sample preparation with enrichment for specific PTMs

    • High-resolution MS/MS analysis

    • Data analysis with appropriate PTM search algorithms

  • Western blot analysis with PTM-specific antibodies

    • Phosphorylation, ubiquitination, SUMOylation detection

    • Treatment with specific inhibitors or inducers

  • Site-directed mutagenesis of predicted PTM sites

    • Functional analysis of mutants

    • Comparison with wild-type protein behavior

The methodological approach should include purification of YIP5 under conditions that preserve PTMs (phosphatase inhibitors, deubiquitinase inhibitors) followed by comprehensive mass spectrometry analysis with multiple proteolytic digestions to ensure complete sequence coverage.

What are the optimal conditions for studying YIP5 in in vitro biochemical assays?

Effective biochemical characterization of YIP5 requires careful consideration of:

  • Buffer optimization

    • pH range testing (typically 6.5-8.0)

    • Salt concentration optimization (100-500 mM)

    • Addition of stabilizing agents (glycerol, reducing agents)

  • Protein stability assessment

    • Thermal shift assays

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Circular dichroism for secondary structure analysis

  • Functional assays

    • ATPase/GTPase activity (if predicted)

    • Binding studies with potential interactors

    • Enzymatic activity assessments based on predicted function

Researchers should establish optimal storage conditions (temperature, buffer components, additives) that maintain YIP5 stability and functionality for extended periods.

How might high-throughput screening approaches advance YIP5 research?

High-throughput screening (HTS) provides powerful opportunities for YIP5 functional characterization:

  • Chemogenomic profiling

    • Screening YIP5 deletion strains against diverse compound libraries

    • Identification of chemical-genetic interactions

  • CRISPR-based screens

    • Genome-wide screens in YIP5 deletion backgrounds

    • Identification of synthetic lethal/sick interactions

  • Functional genomics approaches

    • Systematic overexpression studies

    • Conditional degradation systems for temporal control

The methodological approach should include careful design of screening conditions, appropriate controls, and robust statistical analysis to identify true positives while minimizing false discoveries.

What computational approaches can predict YIP5 function and interactions?

Computational methods offer valuable insights for directing experimental YIP5 research:

  • Homology modeling and structural prediction

    • Identification of structural homologs

    • Prediction of functional domains

  • Protein-protein interaction network analysis

    • Integration with existing yeast interactome data

    • Prediction of functional modules

  • Evolutionary analysis

    • Identification of conserved regions

    • Prediction of functionally important residues

Researchers should integrate multiple computational approaches while validating predictions through focused experimental studies. Particular attention should be paid to evolutionary conservation patterns across fungal species to identify functionally critical residues.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.