Recombinant Saccharomyces cerevisiae Protein YOP1 (YOP1)

Shipped with Ice Packs
In Stock

Description

Functional Roles

YOP1 plays a multifaceted role in cellular processes:

ER Morphology and Biogenesis

  • Tubular ER Formation: Collaborates with Rtn1p and Sey1p to maintain tubular ER networks .

  • Peroxisomal Biogenesis: Facilitates lipid transfer and organelle inheritance during ER stress .

  • COPII Vesicle Formation: Interacts with Yip1p to ensure proper vesicle biogenesis for Golgi transport .

Stress Response and Membrane Dynamics

  • ER Stress Modulation: Regulates asymmetry-induced inheritance blocks during stress, ensuring organelle segregation .

  • DNA Replication Stress: Forms ER foci to manage replication-induced damage .

Interaction Partners and Pathways

YOP1 interacts with key ER-shaping and trafficking proteins:

Partner ProteinFunctionInteraction StrengthSource
Rtn1pTubular ER formation, phosphatidylserine transfer0.990
Sey1pDynamin-like GTPase for ER fusion0.990
Yip1pCOPII vesicle biogenesis0.870
Lnp1pER junction formation, stress response0.833

These interactions highlight YOP1’s role in a network of proteins that coordinate ER structure and membrane traffic .

Research Findings

Recent studies underscore YOP1’s importance in cellular processes:

ER Fusion and Maintenance

  • Sey1p Dependency: Sey1p-mediated GTP-dependent ER fusion is partially restored by human ATL1 in sey1Δ yop1Δ mutants, confirming conserved mechanisms .

  • Tubule Isolation: Affinity purification of YOP1-bound ER tubules identified 79 enriched proteins, including lipid metabolism and trafficking components .

Genetic and Functional Studies

  • Double Mutants: sey1Δ yop1Δ and rtn1Δ yop1Δ show sheet-like ER morphology, emphasizing YOP1’s redundancy in tubule formation .

  • Lipid Exchange: YOP1 facilitates phosphatidylserine transfer between ER and mitochondria, critical for organelle communication .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes, and we will do our best to fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
YOP1; YIP2; YPR028W; YP9367.08; Protein YOP1; YIP1 partner protein 1; YPT-interacting protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-180
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YOP1
Target Protein Sequence
SEYASSIHSQMKQFDTKYSGNRILQQLENKTNLPKSYLVAGLGFAYLLLIFINVGGVGEI LSNFAGFVLPAYLSLVALKTPTSTDDTQLLTYWIVFSFLSVIEFWSKAILYLIPFYWFLK TVFLIYIALPQTGGARMIYQKIVAPLTDRYILRDVSKTEKDEIRASVNEASKATGASVH
Uniprot No.

Target Background

Function
YOP1 plays a crucial role in membrane/vesicle trafficking.
Gene References Into Functions
  1. Research suggests that the op1 protein functions as phospholipid-GlcCer flippases. PMID: 22427661
  2. When purified Yop1p was incorporated into proteoliposomes, narrow tubules were generated. Notably, tubule formation occurred with different lipids and required only the central portion of the protein, including its two long hydrophobic segments. PMID: 18309084
Database Links

KEGG: sce:YPR028W

STRING: 4932.YPR028W

Protein Families
DP1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Saccharomyces cerevisiae Protein YOP1 and what are its key characteristics?

Yop1 is a yeast DP1 (Deleted in Polyposis) family protein with high sequence conservation with human REEPs (Receptor Expression-Enhancing Proteins). It functions as an integral membrane protein that stabilizes high membrane curvature in the endoplasmic reticulum . The full-length mature Yop1 protein consists of 179 amino acids (positions 2-180) and has several synonyms including YIP2 (YPT-interacting protein 2) . Structurally, Yop1 contains transmembrane domains and is capable of forming dimers that are important for its membrane curving activity . The protein is encoded by the YOP1 gene and has the UniProt ID Q12402 .

How should recombinant YOP1 be reconstituted and stored for optimal stability?

For reconstitution of lyophilized YOP1 protein, it is recommended to first briefly centrifuge the vial prior to opening to bring the contents to the bottom. The protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . For long-term storage, it is advisable to add glycerol to a final concentration of 5-50% (with 50% being commonly used) and to aliquot the protein solution before storing at -20°C or -80°C .

To avoid protein degradation, repeated freeze-thaw cycles should be avoided. For short-term use, working aliquots can be stored at 4°C for up to one week . The reconstituted protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0 to maintain stability .

How does YOP1 contribute to membrane curvature generation in cellular systems?

Yop1 plays a critical role in stabilizing high membrane curvature in the endoplasmic reticulum and phagophores . The mechanism involves Yop1 dimers inserting into lipid bilayers and inducing or stabilizing membrane curvature through a combination of wedging and scaffolding effects. The stability of these dimers and their ability to adopt different conformations are essential for membrane curvature generation .

Research has shown that Yop1 is sufficient to stabilize lipid membrane tubules both in cells and in vitro . When reconstituted into E. coli polar lipid extract, wild-type Yop1 forms a mixture of tubules and small spherical vesicles with diameters of 15-20 nm, which are likely monolayered lipoprotein particles (LPPs) . This ability to generate and stabilize highly curved membrane structures is fundamental to the protein's biological function in shaping the endoplasmic reticulum network .

What protocols are recommended for in vitro Yop1 tubulation assays?

For conducting Yop1 tubulation assays, researchers should follow these methodological steps:

  • Prepare Yop1 protein samples at a concentration of 0.25 mg/ml.

  • Mix the protein in a 1:1 mass ratio with E. coli Polar Lipid Extract (available from commercial sources like Avanti Polar Lipids) resuspended in reconstitution buffer (25 mM HEPES pH 7.0, 150 mM KCl, 5% Glycerol, 1 mM EDTA, 1% DM) .

  • Keep the protein, lipid, and detergent solution on ice for 30 minutes to allow proper interaction.

  • Add Bio-beads SM-2 Resin (Bio-Rad) in small increments over three days while incubating at room temperature on a rotating wheel. This gradual addition helps remove the detergent and promotes membrane reconstitution .

  • For visualization, apply the membrane-reconstituted Yop1 samples to glow-discharged carbon-layered copper grids and incubate for 2 minutes before blotting with filter paper.

  • Stain the grids with 20 μl of 2% uranyl acetate for 10 seconds, blot with filter paper, and allow to dry at room temperature.

  • Record images using transmission electron microscopy (e.g., TEM Philips Tecnai 12 at 120 keV) at an appropriate magnification (e.g., 49,000×) .

  • Quantify maximum end-to-end particle lengths using image analysis software such as Fiji .

This protocol allows for the visualization and quantification of Yop1's ability to form membrane tubules in vitro, providing insights into its membrane-shaping properties.

How can YOP1-containing microsomes be isolated for biochemical studies?

To isolate Yop1-containing microsomes from yeast cells, researchers can follow this procedure:

  • Prepare a P100k fraction (pelleted material after centrifugation at 100,000 × g) from cellular lysates.

  • Resuspend the P100k in 700 μL of lysis buffer containing 150 mM NaCl and place on ice for 15 minutes.

  • Add 40 μL of anti-Flag affinity gel (if working with Flag-tagged Yop1) according to the manufacturer's instructions and rotate for 2 hours at 4°C.

  • Pellet the affinity gel with bound vesicles by centrifugation at 800 × g at 4°C for 2 minutes.

  • Wash twice with 700 μL of lysis buffer plus 150 mM NaCl .

For different downstream applications:

  • For Western blot analysis: Boil the pellet directly in 2× SDS-PAGE sample loading buffer.

  • For mass spectrometric analysis: Solubilize the pellet in 0.1 M ABC buffer containing 0.1% RapiGest SF and boil for 20 minutes. Collect the supernatant for mass spectrometry.

  • For Percoll gradient assay: Resuspend the pellet in lysis buffer containing Flag peptides (1 μg/μL) to elute the bound vesicles .

This protocol enables the isolation of Yop1-containing membrane fractions for various biochemical and structural studies.

How do specific mutations in YOP1 affect its oligomerization and membrane curvature generation?

Research on mutations in the Yop1 sequence has revealed differential effects on protein oligomerization and membrane curvature generation capabilities. Several mutations corresponding to those found in the human ortholog REEP1 (associated with Hereditary Spastic Paraplegia type 31) have been studied in the Yop1 context .

Key findings from mutation studies include:

  • P71L mutation:

    • Results in polydisperse oligomerization rather than stable dimers

    • Significantly impairs membrane tubule formation

    • Leads to protein aggregation with no clear examples of regular tubular or LPP particles

    • The proline at this position is strictly conserved and is located in TM2 at the intramolecular interface with TM3

  • S75F mutation:

    • Shows intermediate effects on stability and oligomerization homogeneity

    • Can form tubules and LPPs similar to wild-type Yop1 but with greater variation in particle sizes

    • The serine at this position is predicted to form a hydrogen bond with W94, and only serine, threonine, or cysteine are found at this position in DP1 homologs

  • A72E mutation:

    • Introduces new polar interactions between subunits that stabilize the Yop1 dimer

    • Produces many tubular particles comparable in length to wild-type Yop1

    • Forms few or no spherical LPP particles, suggesting an inability to form highly curved structures

    • Shows high solubility and homogeneity, making it suitable for crystallization trials

These findings suggest that the membrane-curving activity of DP1 proteins requires both dimer stability and conformational plasticity at the intermolecular interface .

What is the relationship between YOP1 dimer stability and membrane curvature generation?

The relationship between Yop1 dimer stability and membrane curvature generation is complex and critical for the protein's function. Research indicates that while dimer formation is necessary for membrane curving activity, excessive stabilization of the dimer can actually impair the formation of highly curved membrane structures .

When a BRIL domain was introduced to the cytoplasmic loop of the A72E variant (between residues S84 and T85), the construct regained the ability to form LPPs exclusively, rather than tubules . This result indicates that dimer "splaying" or conformational flexibility is required for stabilizing highly curved membranes. The BRIL insertion likely causes steric hindrance that forces the dimer to adopt configurations compatible with higher curvature formation .

These findings support a model where the membrane-curving activity of DP1 proteins like Yop1 requires a balance between dimer stability and conformational plasticity at the intermolecular interface.

How does the insertion of domains like BRIL affect YOP1 structure and function?

The insertion of domains such as the thermostabilized cytochrome b562 RIL (BRIL) into Yop1 can significantly alter its membrane-shaping properties while maintaining protein expression and stability. When BRIL was inserted into the cytosolic loop of the A72E variant between residues S84 and T85, the resulting construct (A72E-BRIL) showed yields comparable to those of A72E alone but formed exclusively lipoprotein particles (LPPs) instead of the tubules observed with A72E .

This experimental approach demonstrates how domain insertions can be used as a tool to probe structure-function relationships in membrane-shaping proteins like Yop1. It also provides insights into the mechanisms by which these proteins generate different degrees of membrane curvature, highlighting the importance of conformational dynamics in their function .

What is the relationship between yeast YOP1 and human REEP proteins?

Yeast Yop1 and human REEP (Receptor Expression-Enhancing Protein) proteins share significant sequence and functional conservation, making Yop1 a valuable model for understanding human REEP biology. Both belong to the DP1 family of integral membrane proteins that stabilize high membrane curvature in the endoplasmic reticulum .

Sequence alignment between human REEPs (there are six human REEP proteins) and characterized yeast DP1 proteins shows strong amino acid conservation across transmembrane helices two to four and the C-terminal amphipathic helix . This high sequence conservation from yeast to humans, coupled with the ability of both Yop1 and REEP1 to stabilize high membrane curvature in cells and in vitro, suggests that insights from Yop1 studies can be applicable to understanding human REEP function .

Mutations in the human DP1 gene REEP1 are associated with Hereditary Spastic Paraplegia type 31 and distal hereditary motor neuropathy . Several missense mutations found in human REEP1 map to a putative dimerization interface, and when corresponding mutations are introduced into the yeast Yop1 context, they show various effects on dimer structure and tubulation activity. This conservation of structure-function relationships further supports the use of Yop1 as a model for studying human REEP proteins .

How is YOP1 involved in proteomics studies of the endoplasmic reticulum?

Yop1 has been used in quantitative proteomics studies to identify and characterize proteins enriched in tubular endoplasmic reticulum (ER) structures. Research has shown that Yop1 is one of 79 proteins enriched in ER tubules, including known proteins that organize the tubular ER network .

For proteomics studies, Yop1-containing microsomes can be isolated using methodologies involving cell lysis, membrane fractionation, and affinity purification. Specifically, P100k membrane fractions can be resuspended and incubated with anti-Flag affinity gel (when working with Flag-tagged Yop1), followed by washing and elution steps . The isolated Yop1-containing vesicles can then be analyzed using mass spectrometry to identify associated proteins.

This approach allows researchers to characterize the protein composition of specialized ER domains and understand how proteins like Yop1 contribute to ER morphology and function. The identification of proteins co-enriched with Yop1 can provide insights into the molecular mechanisms underlying ER tubule formation and maintenance .

What are common challenges in working with recombinant YOP1 and how can they be addressed?

When working with recombinant Yop1 protein, researchers may encounter several challenges that can be addressed using specific strategies:

  • Protein stability issues:

    • Challenge: Repeated freeze-thaw cycles can lead to protein degradation and loss of activity.

    • Solution: Aliquot the protein solution after reconstitution and store working aliquots at 4°C for up to one week. For long-term storage, add 5-50% glycerol (final concentration) and store at -20°C/-80°C .

  • Membrane reconstitution difficulties:

    • Challenge: Inefficient incorporation of Yop1 into lipid membranes.

    • Solution: Ensure gradual removal of detergent using Bio-beads over three days while maintaining rotation at room temperature. This slow process promotes proper protein integration into lipid bilayers .

  • Variability in tubulation assays:

    • Challenge: Inconsistent results in membrane tubulation experiments.

    • Solution: Maintain consistent protein:lipid ratios (1:1 mass ratio is recommended) and use standardized lipid compositions (e.g., E. coli Polar Lipid Extract). Ensure proper negative staining procedures for electron microscopy visualization .

  • Oligomerization heterogeneity:

    • Challenge: Polydisperse oligomerization affecting functional assays.

    • Solution: Consider introducing stability-enhancing modifications like the A72E mutation, which promotes homogeneous dimer formation, though be aware this may affect membrane curvature generation properties .

  • Visualization of membrane structures:

    • Challenge: Difficulty in visualizing and quantifying Yop1-induced membrane structures.

    • Solution: Use glow-discharged carbon-layered copper grids for sample preparation, optimal staining with 2% uranyl acetate, and appropriate electron microscopy settings. Quantify structures using image analysis software like Fiji for reproducible measurements .

Addressing these challenges requires careful attention to experimental conditions and protocols, which will help ensure reliable and reproducible results when working with recombinant Yop1 protein.

How can researchers interpret contradictory data in YOP1 mutation studies?

When encountering contradictory data in Yop1 mutation studies, researchers should consider several factors that might explain the discrepancies:

  • Context-dependent effects:

    • The same mutation may have different effects depending on the experimental system (in vivo vs. in vitro), lipid composition, or presence of interacting partners.

    • For example, mutations that show minimal effects in cellular systems might display significant alterations in purified protein assays due to the absence of compensatory mechanisms .

  • Multiple functional modes:

    • Yop1 functions through both homo-oligomerization and interaction with other proteins like reticulons.

    • A mutation might affect one aspect of function (e.g., dimer stability) while preserving others (e.g., interaction with binding partners) .

  • Methodological differences:

    • Variations in protein preparation, membrane reconstitution protocols, or analytical techniques can lead to apparently contradictory results.

    • For instance, the A72E mutation produced tubules in standard reconstitution assays but exclusively formed LPPs when a BRIL domain was inserted into the cytosolic loop .

  • Balance between competing properties:

    • Yop1 function requires a balance between dimer stability and conformational flexibility.

    • The P71L mutation decreased dimer stability and impaired tubulation, while A72E increased dimer stability but prevented formation of highly curved LPPs, suggesting an optimal middle ground is required .

To resolve contradictions, researchers should conduct comprehensive analyses combining multiple approaches:

  • Structural predictions and molecular dynamics simulations

  • In vitro reconstitution assays with defined lipid compositions

  • Cellular localization and functional studies

  • Biophysical measurements of protein-protein and protein-lipid interactions

  • Systematic mutagenesis to map functional domains

This multi-faceted approach will help distinguish genuine biological complexity from technical artifacts and provide a more complete understanding of Yop1 structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.