Recombinant Saccharomyces cerevisiae Protein YRO2 (YRO2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Cellular Processes

YRO2 functions as a transporter linked to weak acid stress tolerance and metabolic intermediate regulation:

  • Weak Acid Resistance: YRO2 and its homolog Mrh1 enhance tolerance to acetate and lactate by exporting toxic anions .

  • Metabolite Transport: It facilitates the secretion of 2,3-dihydroxyisovalerate (DIV), a precursor in isobutanol biosynthesis. Deletion of YRO2 reduces DIV secretion by 20–30%, altering metabolic flux toward acetoin and 2,3-butanediol .

  • Genetic Interactions: Acts synergistically with TPO2 and TPO3 (polyamine transporters) in stress response pathways .

Research Findings on YRO2 Deletion

A 2017 study investigated YRO2 knockout strains in engineered S. cerevisiae for isobutanol production :

ParameterΔYRO2 StrainWild-Type Strain
DIV Secretion70–80% reductionBaseline levels
Acetoin Production2.1-fold increaseNo significant change
2,3-Butanediol Accumulation1.8-fold increaseMinimal accumulation
Weak Acid SusceptibilityEnhanced sensitivityModerate tolerance

This phenotype suggests YRO2’s role in maintaining intracellular DIV equilibrium, indirectly influencing branched-chain alcohol synthesis .

Applications in Biotechnology

Recombinant YRO2 is utilized in:

  • Metabolic Engineering: Modulating DIV secretion to optimize isobutanol yields in biofuel production .

  • Stress Response Studies: Probing mechanisms of weak acid tolerance in industrial yeast strains .

  • Protein Interaction Networks: YRO2 interacts with 60 unique genes, including regulators of membrane trafficking and ion homeostasis .

Recombinant YRO2 Production and Availability

The recombinant protein is commercially available with the following specifications :

ParameterDetail
Host SpeciesSaccharomyces cerevisiae (strain S288C)
Purification TagHis-tag (C- or N-terminal, determined during production)
Storage ConditionsTris-based buffer with 50% glycerol; stable at -20°C or -80°C
ApplicationsELISA, protein-protein interaction assays, enzymatic studies

Production employs episomal plasmids (YEp) or integrative vectors for stable expression .

Future Directions

While YRO2’s transport mechanism remains partially characterized, its engineering potential in synthetic biology is underscored by its role in metabolite redistribution and stress adaptation. Ongoing studies aim to exploit its regulatory properties for advanced biomanufacturing platforms .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please include your desired format in your order notes and we will do our best to fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are sent with standard blue ice packs. If you require dry ice shipping, please notify us in advance and additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
YRO2; YBR054W; YBR0507; Protein YRO2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-344
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YRO2
Target Protein Sequence
MSDYVELLKRGGNEAIKINPPTGADFHITSRGSDWLFTVFCVNLLFGVILVPLMFRKPVK DRFVYYTAIAPNLFMSIAYFTMASNLGWIPVRAKYNHVQTSTQKEHPGYRQIFYARYVGW FLAFPWPIIQMSLLGGTPLWQIAFNVGMTEIFTVCWLIAACVHSTYKWGYYTIGIGAAIV VCISLMTTTFNLVKARGKDVSNVFITFMSVIMFLWLIAYPTCFGITDGGNVLQPDSATIF YGIIDLLILSILPVLFMPLANYLGIERLGLIFDEEPAEHVGPVAEKKMPSPASFKSSDSD SSIKEKLKLKKKHKKDKKKAKKAKKAKKAKKAQEEEEDVATDSE
Uniprot No.

Target Background

Database Links

KEGG: sce:YBR054W

STRING: 4932.YBR054W

Protein Families
Archaeal/bacterial/fungal opsin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems can be used to produce recombinant YRO2?

Recombinant YRO2 can be produced in several expression systems, with E. coli and S. cerevisiae being the most common:

Expression SystemAdvantagesConsiderationsTags Recommended
E. coliHigh yield, rapid growthLack of post-translational modificationsHis-tag, GST-tag
S. cerevisiaeNative post-translational modificationsSlower growth than bacteriaHis-tag, Aga2 display system
P. pastorisHigh density culture, high yieldNeed for optimizationHis-tag, FLAG-tag

For YRO2, expressing in S. cerevisiae may be advantageous when studying functional aspects that require native modifications, while E. coli expression is suitable for structural studies requiring large protein amounts .

How can I optimize expression of recombinant YRO2 in S. cerevisiae?

Optimizing YRO2 expression requires careful consideration of several parameters:

  • Promoter selection: The strength and inducibility of promoters significantly affect expression levels. For constitutive expression, the GAPDH promoter is effective. For inducible expression, consider:

    • GAL1 promoter (galactose-inducible)

    • CUP1 promoter (copper-inducible)

    • TEF1 promoter (strong constitutive expression)

  • Codon optimization: Though expressing YRO2 in its native host doesn't typically require codon optimization, codon usage should be considered if expressing in other systems.

  • Culture conditions: Optimization of:

    • Media composition (YPD for maximal biomass)

    • Growth temperature (30°C standard, 25°C for improved folding)

    • pH (4.5-6.0 range)

    • Induction timing (typically mid-log phase)

  • Overexpression of chaperones: Co-expression of chaperones like SSA1, YDJ1, and SSE1 has been shown to improve expression of complex proteins in S. cerevisiae by up to 3-fold in some cases .

What are the most effective methods for purifying recombinant YRO2?

Purification of YRO2 involves several critical steps:

  • Cell lysis: For membrane proteins like YRO2, gentle lysis methods are recommended:

    • Glass bead disruption with appropriate buffers containing protease inhibitors

    • Enzymatic methods using zymolyase followed by gentle mechanical disruption

  • Solubilization: Due to its membrane-associated nature, YRO2 requires proper solubilization:

    • Use of detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

    • Optimization of detergent concentration is crucial for maintaining protein structure

  • Affinity chromatography: If expressing with tags:

    • His-tagged YRO2: Nickel or cobalt affinity chromatography

    • GST-tagged YRO2: Glutathione-Sepharose affinity chromatography

  • Size exclusion chromatography: For increased purity and to verify the oligomeric state of YRO2 .

How can I design a Western blot protocol to confirm complete expression of YRO2?

A robust strategy for confirming complete expression of YRO2 involves a dual-tagging approach:

  • Construct design: Tag YRO2 at both N and C termini with different tags:

    • N-terminus: FLAG or HA tag

    • C-terminus: His tag or myc tag

  • SDS-PAGE conditions:

    • 12% polyacrylamide gel for optimal separation

    • Transfer to PVDF membrane using semi-dry or wet transfer methods

  • Dual antibody detection:

    • Probe with antibodies against both N and C-terminal tags

    • Detection of both tags at the same molecular weight position confirms intact protein

    • Different positions indicate proteolytic cleavage or degradation

  • Controls:

    • Include known intact tagged YRO2 as positive control

    • Include lysates from non-transformed yeast as negative control

This dual-tagging strategy is particularly valuable for membrane proteins like YRO2 that may be subject to proteolytic processing or degradation during expression .

What are the known functions of YRO2 and how can they be studied experimentally?

YRO2 is involved in several cellular processes in S. cerevisiae:

  • Stress response: YRO2 is implicated in cellular responses to various stresses, particularly oxidative stress and weak acid stress.

  • Membrane integrity: As a membrane protein, YRO2 appears to play a role in maintaining membrane function under stress conditions.

  • Potential interaction with redox systems: While not conclusively determined, YRO2 may interact with redox systems similar to other proteins involved in oxidative stress responses.

To study these functions experimentally, researchers can employ:

  • Gene knockout/knockdown studies: Analyze phenotypes of Δyro2 strains under different stress conditions

  • Overexpression studies: Examine effects of YRO2 overexpression on stress tolerance

  • Localization studies: Use GFP-fusion proteins to track subcellular localization under different conditions

  • Interactome analysis: Employ co-immunoprecipitation followed by mass spectrometry to identify interaction partners

How does YRO2 respond to acetic acid and other weak acid stresses?

YRO2 has been implicated in the response to weak acid stress, particularly acetic acid stress. Research indicates:

  • Expression regulation: YRO2 expression is upregulated during weak acid stress, suggesting a protective role:

    • Increased transcription observed within 30 minutes of acetic acid exposure

    • Regulation may involve the Haa1 transcription factor, a key regulator of adaptation to weak acids

  • Membrane integrity: YRO2 may function in maintaining membrane integrity during weak acid stress:

    • Contributes to altered membrane composition

    • May interact with sphingolipid biosynthesis pathways

  • Experimental approaches:

    • Transcriptional profiling using RT-qPCR to measure YRO2 expression levels under acetic acid stress

    • Growth assays comparing wild-type and Δyro2 strains at different acetic acid concentrations

    • Lipidomic analysis to assess membrane composition changes dependent on YRO2

For researchers studying YRO2's role in acetic acid response, the following experimental setup is recommended:

ParameterRecommended ConditionNotes
Acetic acid concentration0.05-0.1% (v/v)Sublethal stress for most S. cerevisiae strains
Medium pH4.0-4.5Ensures acetic acid is in undissociated form
Growth phaseEarly exponentialCells more sensitive to stress
ControlsΔhaa1 strainKnown acetic acid sensitive strain

How is YRO2 involved in oxidative stress response and redox homeostasis?

YRO2 appears to participate in oxidative stress response pathways, though its exact mechanism remains under investigation:

  • Potential mechanism: YRO2 may function similarly to other membrane proteins involved in maintaining redox homeostasis:

    • Could participate in detoxification of reactive oxygen species (ROS)

    • May interact with glutaredoxin systems or other redox-active proteins

  • Relationship with mitochondrial function: Evidence suggests YRO2 may influence mitochondrial-related stress responses:

    • May play a role in retrograde signaling under oxidative stress conditions

    • Could interact with mitochondrial membrane proteins

  • Experimental approaches to study YRO2 in redox homeostasis:

    • Measurement of intracellular ROS levels in wild-type vs. Δyro2 strains

    • Determination of glutathione (GSH/GSSG) ratios in the presence and absence of YRO2

    • Protein-protein interaction studies with known redox proteins (e.g., glutaredoxins)

How can I design a DOE approach to optimize YRO2 expression and purification?

Design of Experiments (DOE) provides a systematic approach to optimize multiple parameters simultaneously while minimizing experimental runs:

  • Factor selection: For YRO2 expression and purification, consider these key factors:

    • Temperature (25°C, 30°C)

    • Induction time (OD600 = 0.6, 1.0, 1.5)

    • Media composition (YPD, minimal media with supplementation)

    • pH (4.5, 5.5, 6.5)

    • For purification: detergent type (DDM, digitonin) and concentration

  • DOE design: A fractional factorial design is recommended to balance resource use with information gain:

    • Start with a screening design to identify significant factors

    • Follow with response surface methodology to optimize significant factors

  • Implementation in JMP or similar software:

    • Create a data table with factors at multiple levels

    • For each combination, measure response variables (protein yield, purity, activity)

    • Analyze to determine optimal conditions and factor interactions14

Example DOE setup in JMP software for YRO2 expression optimization:

  • Select DOE → Classical → Two Level Screening

  • Define factors:

    • Temperature (continuous, 25-30°C)

    • Induction OD (continuous, 0.6-1.5)

    • Media (categorical, YPD/Minimal)

    • pH (continuous, 4.5-6.5)

  • Define responses:

    • Protein yield (mg/L)

    • Protein purity (%)

    • Activity (relative units)

  • Generate design table and execute experiments

  • Analyze results to determine optimal conditions14

What proteomic approaches can reveal YRO2 interactions and modifications?

Advanced proteomic methods can provide deep insights into YRO2 function:

  • Interactome analysis:

    • Immunoprecipitation coupled with mass spectrometry (IP-MS)

    • Proximity-based labeling methods (BioID, APEX) for capturing transient interactions

    • Split-ubiquitin membrane yeast two-hybrid for membrane protein interactions

  • Post-translational modifications (PTMs):

    • Phosphoproteomics to identify phosphorylation sites

    • Targeted MS methods to quantify specific PTMs under different conditions

    • Application of enrichment strategies for specific modifications

  • Quantitative proteomics for studying YRO2 response:

    • SILAC or TMT labeling for comparing protein abundances across conditions

    • Parallel reaction monitoring (PRM) for targeted quantification

    • Data-independent acquisition for comprehensive proteome coverage

For researchers conducting interactome studies, analysis of proteomic changes during stress conditions reveals proteins likely to interact with YRO2:

Protein ClassExamplesPotential Interaction with YRO2
Heat shock proteinsSsa1, Ydj1, Sse1Assistance in proper folding and membrane insertion
Redox proteinsGlutaredoxins, thioredoxinsMaintenance of redox state during stress
Membrane proteinsTransporters, ion channelsCooperative functions in membrane integrity

How can CRISPR-Cas and recombinase technologies be applied to study YRO2 function?

Modern genome editing approaches offer powerful tools for YRO2 functional studies:

  • CRISPR-Cas9 applications:

    • Precise gene knockout of YRO2 with minimal off-target effects

    • Introduction of point mutations to study specific domains

    • CRISPRi for conditional downregulation of YRO2 expression

    • CRISPRa for upregulation of YRO2 in specific conditions

  • Site-specific recombinase systems:

    • Cre-LoxP system for conditional YRO2 knockout

    • Application of orthogonal LoxPsym variants for complex genetic manipulations

    • FLP-FRT system for marker recycling in multiple genetic modifications

  • Combinatorial approaches:

    • Multiplex genome editing for studying YRO2 with its potential interaction partners

    • Sequential editing to create libraries of YRO2 variants

    • Integration of reporter systems for real-time monitoring of YRO2 expression

For researchers interested in precise modification of YRO2, the recent development of 16 orthogonal LoxPsym variants provides powerful tools for complex genetic engineering:

  • Create conditional expression systems where YRO2 can be selectively deleted in specific conditions

  • Generate fusion constructs where different domains can be swapped in and out

  • Develop reporter systems where YRO2 expression drives measurable outputs

How does YRO2 contribute to regulated cell death pathways in yeast?

Recent research suggests potential roles for YRO2 in regulated cell death (RCD) pathways:

  • Connection to mitochondrial function:

    • YRO2 may influence mitochondrial membrane integrity during stress

    • Potential involvement in retrograde signaling pathways during mitochondrial dysfunction

  • Relationship to oxidative stress-induced cell death:

    • Similar to other membrane proteins involved in redox homeostasis, YRO2 may modulate ROS production

    • May influence cytochrome c release during apoptotic-like cell death

  • Experimental approaches to study YRO2 in RCD:

    • Flow cytometry with annexin V/PI staining to assess cell death modes

    • Measurement of cytochrome c release in wild-type vs. Δyro2 strains

    • Assessment of mitochondrial membrane potential under stress conditions

    • Quantification of ROS production during cell death induction

The roles of YRO2 in RCD can be studied using acetic acid as a stress inducer, with the following protocol adaptations:

ParameterConditionsPurpose
Acetic acid concentration120-180 mMInduces regulated cell death
Cell densityOD600 = 0.6-0.8Mid-log phase sensitivity
Timepoints15, 60, 120, 200 minCapture different phases of RCD
Key measurementsROS, cytochrome c, mitochondrial ΔΨCore apoptotic markers

This approach allows researchers to determine if YRO2 acts as a pro-survival or pro-death factor under specific stress conditions .

How does YRO2 function compare across different yeast species?

YRO2 homologs exist across various yeast species, with functional conservation and divergence:

  • Comparative analysis between S. cerevisiae and Z. bailii:

    • Z. bailii shows higher tolerance to weak acids, potentially involving YRO2 homologs

    • Expression patterns of YRO2 homologs differ between species under stress

    • Differences in post-translational regulation may contribute to varied stress responses

  • Functional complementation studies:

    • Expression of YRO2 homologs from acid-tolerant yeasts in S. cerevisiae Δyro2 strains

    • Assessment of whether heterologous YRO2 can restore stress tolerance

    • Identification of critical domains through chimeric protein construction

  • Evolutionary conservation:

    • YRO2 appears to be conserved among Saccharomycetaceae

    • Sequence divergence in transmembrane domains suggests adaptation to different cellular environments

How can systems biology approaches enhance our understanding of YRO2 function?

Systems biology offers integrative frameworks to understand YRO2 within broader cellular contexts:

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics data to position YRO2 in cellular networks

    • Map changes in metabolic fluxes in the presence and absence of YRO2

    • Identify condition-specific regulatory networks involving YRO2

  • Genome-scale models:

    • Incorporate YRO2 into proteome-constrained genome-scale models like pcSecYeast

    • Simulate effects of YRO2 perturbation on cellular physiology

    • Predict potential phenotypic outcomes of YRO2 manipulation

  • Network analysis approaches:

    • Construct protein-protein interaction networks centered on YRO2

    • Identify functional modules and pathways associated with YRO2

    • Apply machine learning to predict novel functions based on network position

By applying these integrative approaches, researchers can position YRO2 within the broader context of cellular stress responses and identify previously unrecognized functions and interactions.

What emerging technologies could advance our understanding of YRO2 function?

Several cutting-edge technologies hold promise for deeper insights into YRO2:

  • Cryo-electron microscopy:

    • Determination of YRO2 structure in membrane environments

    • Visualization of conformational changes under different conditions

    • Structural basis for interactions with other proteins

  • Single-cell approaches:

    • Single-cell RNA-seq to capture heterogeneity in YRO2 expression

    • Time-lapse microscopy with fluorescent reporters to track YRO2 dynamics

    • Microfluidic platforms for precise manipulation of cellular environments

  • In situ structural biology:

    • Cellular electron cryotomography to visualize YRO2 in native context

    • Integration of cross-linking mass spectrometry for interaction mapping

    • Application of expanded microscopy for super-resolution imaging

These approaches will help resolve outstanding questions about YRO2's precise molecular function and its dynamic behavior within living cells.

What are the key unanswered questions about YRO2 function and regulation?

Despite progress in understanding YRO2, several critical questions remain:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.