Recombinant Saccharomyces cerevisiae Protoporphyrin uptake protein 1 (PUG1)

Shipped with Ice Packs
In Stock

Description

Functional Role in Heme and Porphyrin Transport

PUG1 regulates the balance between intracellular heme and PPIX through two distinct mechanisms:

Key Findings

  • PPIX Influx: Overexpression increases PPIX uptake by 2.5-fold compared to wild-type strains, enabling heme-deficient cells to bypass heme auxotrophy .

  • Heme Efflux: Reduces intracellular heme accumulation by 40–60% (measured via [55Fe]hemin assays) and lowers activity of heme-dependent enzymes like Fre1p .

  • Induction Conditions:

    • Hypoxia (0.5% O₂): 4.5-fold increase in PUG1 mRNA .

    • Heme starvation (e.g., hem1Δ strains): 6-fold increase in hemin uptake .

Experimental Validation

Localization Studies

  • Immunofluorescence: Pug1p-myc localized to the plasma membrane .

  • Subcellular Fractionation: Cosedimented with plasma membrane marker Pma1p in sucrose gradients, confirming membrane association .

Genetic Manipulations

StrainGenotypePhenotype
pug1ΔPUG1 deletionReduced PPIX uptake, normal heme efflux
PUG1-overexp.Multi-copy plasmidInhibited heme utilization, enhanced PPIX uptake
hem1ΔHeme biosynthesis defect6-fold hemin uptake under ALA starvation

Regulatory Mechanisms

  • Transcriptional Control: Induced under hypoxia via Upc2p, a transcription factor activated by low oxygen .

  • Post-Translational Regulation: Protein levels increase 3-fold under hypoxic conditions, as shown by Western blotting .

Applications and Implications

  • Biotechnological: Potential use in optimizing heme/porphyrin flux in microbial systems for industrial porphyrin production.

  • Medical Insights: Provides a model for studying human disorders linked to porphyrin transport defects, such as erythropoietic protoporphyria .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
PUG1; YER185W; Protoporphyrin uptake protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-303
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
PUG1
Target Protein Sequence
MSTTDSGFVLYHYTPSKAAAIVFVVLFIIMTVIFAVQTLYAARKSSKALKNNPFESSDDK VDSLEDAEYKQLKITPTVFAFIPFFTGCIMEAVGYIGRALSSSNPERTTPYIIQSVLLLV APALIAATIYMIFGRLLHVMRCQSLILISARFGTTFFVVGDVFSFFLQAAGGGLMSKAGS TKTGSGLITAGLFVQVIFFGFFIINEIRFTVNVKRRCLFYEDISRKWIFVNATLLLSSML ILLRSIVRIVEFIQGFNGYIISHEYFIYVFDAVPMLLVIIAFSVGSFFGNVFDVIKECQT LSN
Uniprot No.

Target Background

Function
PUG1 is involved in the inducible influx of protoporphyrin IX and efflux of heme.
Gene References Into Functions
  1. Pug1p induced protoporphyrin IX influx and heme efflux in Saccharomyces cerevisiae. PMID: 18326586
Database Links

KEGG: sce:YER185W

STRING: 4932.YER185W

Protein Families
Lipid-translocating exporter (LTE) (TC 9.A.26.1) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Protoporphyrin Uptake Gene 1 (PUG1) in Saccharomyces cerevisiae?

PUG1 (Protoporphyrin Uptake Gene 1) encodes a plasma membrane protein involved in porphyrin transport in the budding yeast Saccharomyces cerevisiae. Unlike pathogenic fungi, S. cerevisiae does not efficiently use exogenous heme as a nutritional source of iron . Research has shown that PUG1 plays a surprisingly complex role in porphyrin metabolism, with overexpression resulting in reduced utilization of exogenous heme and increased utilization of protoporphyrin IX . The evidence suggests that Pug1p functions in both protoporphyrin IX influx and heme efflux at the plasma membrane, making it an intriguing model for studying bidirectional membrane transport mechanisms .

How is PUG1 expression regulated in S. cerevisiae?

PUG1 expression is induced under conditions of heme starvation and hypoxia . Experimental evidence shows that yeast grown under anaerobic conditions exhibit increased hemin uptake . Similarly, strains lacking aminolevulinate synthase (an enzyme essential for heme biosynthesis) show up to a sixfold increase in hemin uptake when grown without supplementation of 2-aminolevulinic acid . This pattern of regulation suggests that PUG1 is part of an adaptive response to maintain porphyrin homeostasis when endogenous heme synthesis is compromised.

What cellular localization pattern does Pug1p exhibit?

Pug1p has been definitively localized to the plasma membrane through complementary experimental approaches including indirect immunofluorescence and subcellular fractionation . This localization is consistent with its proposed role in mediating the transport of porphyrins between the extracellular environment and the cell interior. The membrane localization provides important context for understanding how the protein functions in modulating the cellular porphyrin pool.

What experimental evidence supports the dual role of Pug1p in both protoporphyrin IX influx and heme efflux?

The bidirectional transport function of Pug1p is supported by several lines of experimental evidence:

  • Strains overexpressing PUG1 exhibited decreased accumulation of [55Fe]hemin compared to wild-type strains, suggesting an enhanced efflux of heme .

  • The same PUG1-overexpressing strains showed increased accumulation of protoporphyrin IX, indicating enhanced influx of this porphyrin precursor .

  • Reporter systems measuring intracellular heme pools (such as CYC1-lacZ) demonstrated patterns consistent with reduced heme retention when PUG1 was overexpressed .

  • Activity measurements of heme-containing proteins (e.g., Fre1p metalloreductase) expressed from constitutive promoters showed changes consistent with altered heme availability in PUG1-manipulated strains .

This apparent bidirectionality with substrate specificity makes Pug1p a particularly interesting model for studying the structural determinants of selective membrane transport.

How does PUG1 function compare between Saccharomyces cerevisiae and pathogenic fungi?

This comparison represents a critical research question with evolutionary implications. While S. cerevisiae cannot efficiently use heme as an iron source, pathogenic fungi like Candida albicans can . The research indicates that C. albicans effectively utilizes exogenous heme as a nutritional iron source, whereas S. cerevisiae does not efficiently incorporate heme-derived iron and does not upregulate heme uptake in response to iron deficiency .

The differences in heme utilization between these species suggest potentially divergent functions or regulatory mechanisms for PUG1 homologs across fungal lineages. Comparative studies examining the functional conservation of PUG1 between pathogenic and non-pathogenic fungi could provide insights into the evolution of nutritional adaptation strategies and the role of porphyrin transport in fungal virulence.

What are the key considerations for designing experiments to characterize PUG1 function?

When designing experiments to investigate PUG1 function, researchers should consider a systematic approach following established experimental design principles:

  • Variable Identification and Control: Clear identification of independent variables (e.g., PUG1 expression levels, oxygen availability), dependent variables (e.g., protoporphyrin IX uptake rates, heme efflux), and control variables (e.g., temperature, media composition) .

  • Hypothesis Formulation: Development of specific, testable hypotheses regarding PUG1's role in porphyrin transport that predict measurable outcomes .

  • Treatment Design: Creation of experimental treatments that effectively manipulate PUG1 expression or activity, including deletion strains (pug1Δ), overexpression systems, and tagged variants .

  • Subject Assignment: Careful consideration of between-subjects or within-subjects designs when comparing different yeast strains or conditions .

  • Measurement Planning: Development of reliable methods to measure porphyrin transport, including radioisotope tracking ([55Fe]hemin), reporter systems (CYC1-lacZ), and enzyme activity assays (Fre1p) .

  • Control for Extraneous Variables: Implementation of strategies to minimize the influence of factors like strain background effects, growth phase variability, and media composition differences .

Experimental ApproachAdvantagesLimitationsKey Applications
Gene deletion (pug1Δ)Reveals loss-of-function phenotypes; establishes necessityMay trigger compensatory mechanisms; subtle effects may be missedBaseline functional characterization; epistasis analysis
Overexpression systemsAmplifies protein activity; useful for detecting mild effectsPotential artifacts from non-physiological levelsTransport measurements; dominant-negative screens
Tagged constructs (PUG1-myc)Enables protein detection and localizationTag may interfere with functionProtein localization; interaction studies
Reporter systems (CYC1-lacZ)Allows indirect measurement of intracellular hemeIndirect nature requires careful interpretationMonitoring heme pools; high-throughput screens

What genetic manipulation strategies are most effective for studying PUG1?

Effective genetic approaches for PUG1 research include:

  • Gene Deletion: PCR-mediated gene disruption can be used to generate pug1Δ strains, with confirmation by PCR testing for correct genomic integration . This approach is valuable for establishing the baseline consequences of PUG1 absence.

  • Overexpression Systems: Cloning PUG1 into vectors such as pYX242 or pYX212 under control of constitutive or inducible promoters allows for controlled expression levels . In vivo recombination in yeast provides an efficient cloning method for generating these constructs.

  • Epitope Tagging: Creation of tagged versions (e.g., PUG1-13myc) enables protein detection while maintaining function . These constructs can be integrated into the genome or expressed from plasmids depending on experimental requirements.

  • Combined Mutations: Creating strains with multiple genetic modifications (e.g., pug1Δ combined with rta1Δ) allows investigation of genetic interactions and pathway relationships .

These genetic tools should be deployed with appropriate controls, including empty vector controls, wild-type complementation, and the use of marker-matched strain backgrounds to ensure experimental validity.

What analytical methods are most effective for measuring PUG1-mediated porphyrin transport?

Several complementary methods can be employed to analyze PUG1-mediated transport:

  • Radioisotope Tracking: Using [55Fe]hemin provides a direct measure of heme movement across the membrane, with quantification of cellular accumulation or depletion over time .

  • Reporter Systems: The CYC1-lacZ reporter, which is activated in the presence of heme, serves as an indirect but quantifiable indicator of intracellular heme availability .

  • Enzyme Activity Assays: Measuring the activity of heme-dependent enzymes such as Fre1p (when expressed from a constitutive promoter) provides a functional readout of accessible heme pools .

  • Fluorescence Methods: The natural fluorescence properties of porphyrins can be exploited for detection and quantification using fluorescence spectroscopy or microscopy.

  • Mass Spectrometry: Techniques such as electrospray ionization mass spectrometry (ESI-MS) can provide qualitative and quantitative analysis of specific sphingolipid species, which could be adapted for porphyrin analysis .

When selecting analytical methods, researchers should consider sensitivity requirements, availability of equipment, and the specific aspect of transport (influx vs. efflux, kinetics, specificity) being investigated.

How can researchers optimize S. cerevisiae strains for PUG1 studies?

Optimization strategies include:

  • Strain Selection: Choosing appropriate background strains (e.g., YPH499, BY4742, BY4741) that are compatible with intended genetic manipulations and experimental readouts .

  • Expression System Selection: Determining whether genomic integration or plasmid-based expression is most appropriate based on expression level requirements and experimental design.

  • Promoter Consideration: Selecting suitable promoters based on experimental needs, as demonstrated in other S. cerevisiae engineering efforts where promoter choice significantly impacts protein expression and activity .

  • Growth Condition Optimization: Developing standardized growth protocols that account for factors known to influence PUG1 expression and function, particularly oxygen availability and porphyrin supplementation .

  • Media Formulation: Creating defined media compositions that control for variables affecting heme synthesis and iron availability to ensure reproducible results.

How should researchers interpret seemingly contradictory data regarding PUG1 function?

When faced with contradictory results in PUG1 research:

What data table structures are most effective for analyzing PUG1 experimental results?

Effective data organization is crucial for PUG1 research analysis. Consider the following approaches:

  • Row-Based Comparison Tables: For comparing specific variables between strains or conditions, using equality operators (=, !=, >, >=, <, <=) to structure the comparison .

  • Column-Based Comparison Tables: When analyzing distributions or patterns across multiple samples or conditions, organizing data to facilitate "in" keyword comparisons .

  • Join-Based Analysis: When integrating data from multiple sources (e.g., genetic information, transport measurements, and protein localization), using data table joins to establish relationships between datasets .

Data TypeTable StructureAnalysis ApproachExample Application
Strain CharacteristicsRow-basedDirect comparison of propertiesComparing PUG1 expression levels across strains
Transport KineticsTime-seriesRate calculation, curve fittingMeasuring protoporphyrin IX uptake over time
Localization DataCategoricalFrequency analysis, distribution mappingQuantifying membrane vs. cytosolic Pug1p
Genetic InteractionsMatrixEpistasis analysis, interaction scoringAssessing PUG1 relationship with RTA1

What are promising future applications of PUG1 research in metabolic engineering?

PUG1 research could contribute to metabolic engineering efforts in several ways:

  • Engineered Porphyrin Production: Understanding and manipulating PUG1 could enhance the production of valuable porphyrin compounds in yeast systems.

  • Platform Strain Development: Similar to how S. cerevisiae has been engineered as a platform for sphingolipid production , PUG1 manipulation could contribute to the development of strains optimized for specific porphyrin processing capabilities.

  • Transport Mechanism Insights: The dual-direction transport function of Pug1p provides a model system for understanding complex membrane transporters, potentially informing the design of other engineered transport systems.

  • Optimization Strategies: Lessons from PUG1 regulation under heme starvation could inform strategies for dynamic regulation of other metabolic pathways in engineered strains.

What structural biology approaches would advance PUG1 research?

Structural characterization of Pug1p would significantly advance our understanding of its mechanism:

  • Crystallography or Cryo-EM: Determining the three-dimensional structure would provide insights into the transport mechanism and substrate binding sites.

  • Structure-Function Analysis: Systematic mutagenesis guided by structural information could map the regions responsible for protoporphyrin IX influx versus heme efflux.

  • Molecular Dynamics Simulations: Computational approaches could model the conformational changes associated with transport and predict the effects of potential modifications.

  • Comparative Structural Analysis: Comparing Pug1p structure with related transporters could illuminate the evolutionary and functional relationships between different porphyrin transport systems.

These structural approaches would complement the genetic and biochemical studies that have established PUG1's role in porphyrin transport and could potentially resolve current mechanistic questions about its bidirectional function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.