Recombinant Saccharomyces cerevisiae Putative DUP240 protein YAR023C (YAR023C)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative DUP240 Protein YAR023C (YAR023C)

Recombinant Saccharomyces cerevisiae Putative DUP240 Protein YAR023C (YAR023C) is a bioengineered version of the endogenous yeast protein encoded by the YAR023C gene. Belonging to the DUP240 multigene family, this transmembrane protein is expressed in heterologous systems (e.g., E. coli) for research and biotechnological applications. While its precise biological role remains uncharacterized, its structural features and production methods are well-documented.

Key Properties

PropertyDetailsSource
Gene NameYAR023C
UniProt IDD6VPM8
Protein LengthFull-length (1–179 amino acids)
Molecular WeightNot explicitly stated; estimated from sequence (~20 kDa)
TagN-terminal 10×His-tag
Host SystemE. coli (most common), yeast, baculovirus, or mammalian cells
Purity≥85% (SDS-PAGE verified)

Amino Acid Sequence

The protein sequence includes hydrophobic regions indicative of transmembrane domains:
MINFLLFVLTILATLTNIWFSGVLSPAMVIRICLGGSMVVLQIWSFSRPISNETFRTKLLLEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGKYPDVQWDTANTQPFISVPENQAATQNSDVEPTVKWCLFKAAEIQAHAVREYWQSQYPDVGIPAI .

Expression and Purification

  • Host: Primarily E. coli for cost-effective production; alternative hosts include yeast or mammalian systems for post-translational modifications .

  • Expression Region: Full-length (1–179 aa) or partial variants (e.g., truncated forms) .

  • Purification: Affinity chromatography (e.g., His-tag binding) or SDS-PAGE validation .

Functional Context

  • DUP240 Family: YAR023C belongs to a multigene family of putative membrane-associated proteins. Functional analysis suggests these proteins are non-essential for yeast viability .

  • Hypothetical Role: The "DUP240" designation implies duplication events in the genome, but no direct evidence links YAR023C to specific cellular pathways (e.g., stress response, transport) .

Experimental Uses

  • Structural Studies: Recombinant YAR023C is used to study transmembrane protein topology or folding.

  • Antibody Development: Polyclonal antibodies (e.g., rabbit anti-YAR023C) enable detection via Western blot or ELISA .

  • Comparative Genomics: Serves as a reference for analyzing DUP240 family evolution in S. cerevisiae .

Product Comparison

Product CodeHost SystemTagProtein LengthPuritySource
CSB-CF520607SVGE. coliHisFull-length≥85%
RFL23486SFE. coliHisFull-length>90%
Partial variantsE. coliHis1–179 (partial)≥85%
Antibody (Rabbit)N/AN/AN/AAffinity

Notes on Product Variability

  • Host Diversity: Yeast or mammalian systems may yield post-translationally modified versions, though E. coli remains the most cost-effective option .

  • Antibody Applications: ELISA and Western blot are validated for detecting YAR023C in yeast lysates or recombinant preparations .

Unresolved Questions

  • Functional Annotation: No high-throughput screens or knockout studies directly link YAR023C to cellular processes.

  • Structural Determination: No crystallographic or cryo-EM data exist for YAR023C, limiting mechanistic insights.

Potential Research Avenues

  • Phylogenetic Analysis: Compare YAR023C homologs across Saccharomyces species to infer evolutionary pressures.

  • Interaction Mapping: Screen for protein partners using yeast two-hybrid or co-IP approaches .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
YAR023C; Putative DUP240 protein YAR023C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YAR023C
Target Protein Sequence
MINFLLFVLTILATLTNIWFSGVLSPAMVIRICLGGSMVVLQIWSFSRPISNETFRTKLL LEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGKYPDVQ WDTANTQPFISVPENQAATQNSDVEPTVKWCLFKAAEIQAHAVREYWQSQYPDVGIPAI
Uniprot No.

Target Background

Gene References Into Functions
  1. This study represents a significant advancement in genome annotation, providing a method for identifying ancient chromosomal rearrangements and elucidating genome history. PMID: 15917500
Database Links

KEGG: sce:YAR023C

STRING: 4932.YAR023C

Protein Families
DUP/COS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YAR023C and what organism does it originate from?

YAR023C is a putative DUP240 family protein found in Saccharomyces cerevisiae, commonly known as baker's yeast. It is classified as a hypothetical protein, indicating that while its gene sequence has been identified, its complete functional characterization remains limited . S. cerevisiae is a unicellular fungal microorganism that has been instrumental in multiple biotechnology applications including winemaking, baking, and brewing, as well as serving as a model organism for eukaryotic cellular research .

What protein family does YAR023C belong to and what are its structural characteristics?

YAR023C belongs to the DUP240 protein family in Saccharomyces cerevisiae . While the search results don't provide detailed structural information specific to YAR023C, DUP240 family proteins typically share conserved domains and structural features. Based on general protein analysis approaches, researchers typically characterize such proteins through sequence alignment with other DUP240 family members, secondary structure prediction, and identification of conserved motifs that may indicate functional regions. Determining the three-dimensional structure would likely require experimental approaches such as X-ray crystallography or NMR spectroscopy, which have not been reported for YAR023C in the provided search results.

What expression systems are available for producing recombinant YAR023C protein?

Multiple expression systems have been developed for producing recombinant YAR023C protein, offering researchers flexibility depending on their experimental requirements. These systems include:

  • E. coli expression systems - Suitable for high-yield bacterial expression

  • Yeast expression systems - Allowing for eukaryotic post-translational modifications

  • Baculovirus expression systems - Useful for insect cell expression of complex proteins

  • Mammalian cell expression systems - Providing mammalian-specific protein processing

  • Cell-free expression systems - Enabling rapid protein production without the constraints of cellular systems

Each expression system has its advantages and limitations, with reported protein purity levels of greater than or equal to 85% as determined by SDS-PAGE for commercially available recombinant versions .

What genetic interaction studies have been performed with YAR023C and what do they reveal?

Genetic interaction studies with YAR023C have revealed important functional relationships with other genes, particularly DHR2. A high-throughput genetic interaction study identified a positive genetic interaction between dhr2-5001 and yar023c with an SGA score of 0.1732 (P-value = 0.01018) . In the context of this research, positive genetic interactions indicate that mutations/deletions in these separate genes, each of which alone causes a minimal phenotype, result in a less severe fitness defect than expected when combined in the same cell under a given condition .

This genetic interaction was identified as part of a global genetic interaction network for Saccharomyces cerevisiae, which included more than 23 million double mutants and identified approximately 550,000 negative and 350,000 positive genetic interactions . The researchers considered genetic interactions significant if they had a p-value < 0.05 and an SGA score > 0.16 for positive interactions and SGA score < -0.12 for negative interactions .

How can researchers validate putative functions of YAR023C using modern molecular biology techniques?

Validating putative functions of YAR023C requires a multi-faceted approach combining genetic, biochemical, and cellular techniques:

  • CRISPR-Cas9 Genome Editing: Researchers can create precise knockouts or modifications of the YAR023C gene to observe resulting phenotypes . This technology allows for targeted genome editing to study gene function.

  • Next-Generation Sequencing Approaches: Technologies such as RNA-Seq can be used to analyze transcriptional changes when YAR023C is deleted or overexpressed, potentially revealing pathways affected by this protein .

  • Proteomics Analysis: Mass spectrometry-based proteomics can identify proteins that interact with YAR023C or undergo changes in abundance or modification state in response to YAR023C manipulation .

  • Cellular Localization Studies: Fluorescently tagged versions of YAR023C can be created to determine its subcellular localization, providing clues to function.

  • Phenotypic Assays: Systematic analysis of cellular phenotypes in YAR023C mutants under various stress conditions can reveal functional roles.

These approaches should be coupled with computational analysis to integrate multiple data types and develop testable hypotheses about YAR023C function.

What immunological methods are available for studying YAR023C?

Several immunological tools have been developed specifically for YAR023C research, enabling detection and characterization of this protein:

  • Polyclonal Antibodies: Rabbit anti-Saccharomyces cerevisiae YAR023C polyclonal antibodies are available for various applications including ELISA and Western Blot analyses . These antibodies are typically purified through antigen-affinity methods and demonstrate reactivity specifically to Saccharomyces cerevisiae .

  • Antibody Applications: Available YAR023C-specific antibodies have been validated for applications including:

    • Western blotting for protein detection

    • ELISA for quantitative analysis

    • Potential applications in immunoprecipitation studies

  • Antibody Characteristics: The commercially available antibodies are typically IgG isotype raised in rabbit hosts and purified through antigen-affinity techniques to ensure specificity .

When utilizing these immunological tools, researchers should follow established protocols for optimal specificity and sensitivity, including proper controls to validate antibody specificity in their experimental system.

How should researchers present YAR023C experimental data in scientific publications?

Presenting YAR023C experimental data in scientific publications requires adherence to established formatting principles to ensure clarity and reproducibility. For tabular data presentation:

Table 1. Genetic Interactions of YAR023C with Selected S. cerevisiae Genes

Interacting GeneInteraction TypeSGA ScoreP-valuePhenotype
DHR2 (dhr2-5001)Positive Genetic0.17320.01018Colony size
[Other genes][Interaction type][Score][P-value][Phenotype]

Note: Genetic interactions were considered significant with p-value < 0.05 and SGA score > 0.16 for positive interactions and SGA score < -0.12 for negative interactions. Data compiled from BioGRID interaction database .

What statistical approaches are appropriate for analyzing YAR023C experimental data?

When analyzing experimental data involving YAR023C, researchers should employ appropriate statistical methods that align with the experimental design and data characteristics:

  • For Genetic Interaction Studies: Statistical significance in genetic interaction studies, as seen with the YAR023C-DHR2 interaction, typically involves calculating p-values to determine whether observed interactions differ significantly from expected values. In the cited study, interactions with p-values < 0.05 were considered statistically significant .

  • For Comparative Expression Analysis: When analyzing expression levels of YAR023C under different conditions or in different strains, statistical approaches such as t-tests (for two-group comparisons) or ANOVA (for multiple group comparisons) are appropriate.

  • For Bioinformatics Analysis: Modern bioinformatics studies involving YAR023C would employ specialized statistical approaches for analyzing 'omics data, such as those used in next-generation sequencing analysis pipelines, which may include various normalization procedures and multiple testing corrections .

  • Data Visualization Tools: Statistical software packages like SPSS can be utilized for data analysis and visualization as mentioned in bioinformatics coursework relevant to this type of research .

  • Reproducibility Considerations: Regardless of the statistical approach, researchers should ensure transparent reporting of statistical methods, including software packages used, significance thresholds, and any data transformations performed.

What bioinformatics approaches can be used to predict YAR023C function?

Bioinformatics approaches offer powerful methods for predicting and analyzing potential functions of YAR023C:

  • Sequence Analysis: Comparison of YAR023C sequences across different yeast species can reveal conserved regions that may indicate functional importance. Multiple sequence alignment tools can identify such regions.

  • Domain Prediction: Analysis of protein domains can provide clues about functionality. Various algorithms can predict potential functional domains within the YAR023C sequence.

  • Structural Prediction: In the absence of experimentally determined structures, computational models can predict the 3D structure of YAR023C based on homology modeling or ab initio approaches.

  • Network Analysis: Integration of YAR023C into protein-protein interaction networks can reveal potential functional associations. The positive genetic interaction with DHR2 already provides a starting point for such network-based analyses .

  • Gene Ontology Analysis: Although the search results indicate that YAR023C doesn't have assigned GO terms yet, analyzing the GO terms of interacting partners like DHR2 can provide functional insights by association .

  • Omics Data Integration: Modern bioinformatics approaches integrate multiple data types, including genomics, proteomics, and metabolomics, to provide a comprehensive understanding of gene function . These approaches are particularly valuable for studying genes like YAR023C with limited functional characterization.

How can next-generation sequencing technologies be applied to study YAR023C?

Next-generation sequencing (NGS) technologies provide powerful tools for studying YAR023C in various contexts:

  • RNA-Seq Analysis: Transcriptome sequencing can reveal how YAR023C expression changes under different conditions or in response to various stressors. This approach can help identify regulatory networks involving YAR023C.

  • ChIP-Seq Applications: If YAR023C has potential roles in DNA binding or chromatin interactions, Chromatin Immunoprecipitation followed by sequencing (ChIP-Seq) could identify genomic binding sites.

  • Whole Genome Sequencing: Analysis of genomic variations in YAR023C across different yeast strains can reveal natural polymorphisms that might be associated with phenotypic differences.

  • CRISPR-Cas Screening: NGS can be combined with CRISPR-Cas systems for genome-wide screening to identify genetic interactions with YAR023C, expanding upon the known interaction with DHR2 .

  • Platform Selection: Modern sequencing platforms like Illumina and Nanostring can be utilized for these applications, as referenced in bioinformatics course curricula focusing on 'omics technologies .

The interpretation of NGS data requires specialized bioinformatics pipelines that handle the large datasets generated by these technologies. Coursework in bioinformatics provides training in statistical methods and data analysis approaches necessary for extracting meaningful biological insights from such data .

What potential therapeutic applications exist for recombinant S. cerevisiae expressing modified proteins?

While not specific to YAR023C, recombinant S. cerevisiae systems have demonstrated therapeutic potential that could inform future applications:

  • Cancer Immunotherapy: Recombinant S. cerevisiae yeast has been engineered to express target proteins that stimulate immune responses against malignant cells. Phase 1 clinical trials have evaluated the safety and immunogenicity of such approaches in patients with advanced colorectal or pancreatic cancer .

  • Specific Applications: The GI-4000 series of products, which express different forms of mutated Ras proteins in S. cerevisiae, has been studied in clinical trials involving 33 heavily pretreated patients with pancreatic and colorectal cancer .

  • Probiotic Applications: S. cerevisiae is used as a probiotic in humans and animals. The strain S. cerevisiae var. boulardii is industrially manufactured and used clinically as a medication for various gastrointestinal conditions .

  • Treatment of Gastrointestinal Diseases: Clinical studies have shown that S. cerevisiae var. boulardii is useful for prevention or treatment of several gastrointestinal diseases, including antibiotic-associated diarrhea, adverse effects of Helicobacter pylori eradication therapy, and traveler's diarrhea .

These established applications could potentially inform future therapeutic strategies involving engineered yeast expressing modified forms of proteins like YAR023C, though specific applications would depend on further characterization of YAR023C function.

What safety considerations should researchers be aware of when working with recombinant S. cerevisiae?

Researchers working with recombinant S. cerevisiae, including strains expressing proteins like YAR023C, should be aware of several safety considerations:

  • Potential for Fungemia: Although rare, cases of fungemia (fungal infection in the bloodstream) have been reported following intentional ingestion of living S. cerevisiae cultures or in immunocompromised patients .

  • Risk Groups: Patients with compromised immunity or those with central vascular catheters are at particular risk for adverse effects. Some researchers recommend avoiding use of S. cerevisiae in such patients, while others suggest exercising caution .

  • Laboratory Safety: Standard microbiological safety practices should be followed when handling recombinant S. cerevisiae, including proper containment, decontamination procedures, and waste disposal.

  • Risk of Contamination: S. cerevisiae var. boulardii may contaminate intravascular catheters through the hands of medical personnel administering probiotic preparations, highlighting the importance of proper handling procedures .

  • Respiratory Exposure: A case report described a nodule in the lung of a bakery worker, with examination revealing the presence of S. cerevisiae. Inhalation of dry yeast powder was proposed as the source of infection, suggesting that laboratory workers should avoid inhalation of yeast cultures .

These safety considerations underscore the importance of proper containment and handling procedures when working with recombinant S. cerevisiae, even though it is generally considered a low-risk organism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.