IRC13 (UniProt ID: Q08630) is a protein encoded by the IRC13 gene (ORF: YOR235W) in S. cerevisiae. Key identifiers include:
| Attribute | Details |
|---|---|
| Gene Name | IRC13 |
| Synonyms | YOR235W, Increased recombination centers protein 13 |
| Protein Length | 104 amino acids (full-length) |
| Source Organism | Saccharomyces cerevisiae |
| Recombinant Host | Escherichia coli |
| Tag | N-terminal His-tag (for purification) |
While genomic databases like SGD classify IRC13 as a dubious ORF due to limited functional evidence , recombinant IRC13 is produced and sold as a research tool .
Recombinant IRC13 is synthesized via bacterial expression systems and purified for experimental use. Key production parameters include:
| Parameter | Details |
|---|---|
| Host | E. coli |
| Tag | N-terminal His-tag |
| Protein Length | Full-length (1–104 aa) |
| Purity | >90% (SDS-PAGE verified) |
| Storage Buffer | Tris/PBS-based buffer with 6% trehalose and pH 8.0 |
| Storage Conditions | -20°C/-80°C (long-term); 4°C (short-term aliquots) |
The recombinant protein’s amino acid sequence is:
MGLYRPSKFFHPPIPHIPFTINPDFFSFHIQRLKAKANPENFLICFPPPDIYKGFVFCCQ LDLVHLFSYVFFLFLLKICVDVLQYVIYPKHFTHKKPGFENYSI .
Despite its dubious classification, IRC13 null mutants exhibit increased spontaneous Rad52p foci, suggesting a role in DNA repair or recombination . Rad52p is a key protein in homologous recombination (HR), and elevated foci indicate genomic instability.
DNA Repair: Potential involvement in resolving spontaneous DNA damage via HR pathways.
Recombination Regulation: May modulate recombination centers to maintain genomic integrity.
| Phenotype | Wild-Type | IRC13 Null Mutant |
|---|---|---|
| Rad52p Foci | Basal levels | Increased spontaneous foci |
| Genomic Stability | Normal | Elevated DNA damage markers |
Recombinant IRC13 is used to study:
DNA Damage Response: Investigating interactions with HR machinery (e.g., Rad52, Srs2).
Protein Interactions: Mapping binding partners via affinity chromatography.
Enzymatic Activity: Testing for intrinsic catalytic roles (e.g., helicase, nuclease).
While specific pathways remain uncharacterized, IRC13 is hypothesized to intersect with:
No direct interactors or orthologs are reported in public databases , indicating IRC13 may be yeast-specific or require further functional studies.
STRING: 4932.YOR235W
IRC (Increased Recombination Centers) proteins in Saccharomyces cerevisiae comprise a family of proteins identified through genetic screens for mutants exhibiting elevated levels of recombination events. These proteins play crucial roles in maintaining genomic stability, particularly during DNA replication, repair, and recombination processes. The IRC gene family includes multiple members (IRC1-IRC25) encoding proteins with diverse functions, many of which remain incompletely characterized.
While IRC13 is among the lesser-studied members, related proteins like Irc3 have been well-characterized as superfamily II DNA helicases that are essential for mitochondrial DNA stability . Classification of IRC proteins is generally based on their molecular functions, with some belonging to helicase superfamilies, others functioning as nucleases, and others still serving as scaffold proteins in multi-protein complexes involved in DNA metabolism.
Current research suggests that IRC proteins display distinct subcellular localization patterns corresponding to their functional roles in DNA metabolism. For instance, Irc3, a superfamily II DNA helicase, is primarily localized to mitochondria where it functions in maintaining mitochondrial DNA stability . Unlike Irc3, which has a defined mitochondrial localization, other IRC proteins may be found in the nucleus where they participate in nuclear DNA maintenance.
The specific localization pattern of IRC13 has not been thoroughly documented in the available literature. Researchers investigating IRC13 localization typically employ fluorescence microscopy techniques with GFP-tagged constructs or immunofluorescence methods with protein-specific antibodies to determine its subcellular distribution. Comparative localization studies between different IRC proteins can provide valuable insights into their potential functional relationships and distinct roles in DNA metabolism.
Deletion or mutation of IRC genes typically results in phenotypes related to genomic instability. While specific phenotypes for IRC13 mutations are not extensively documented in the provided literature, deletion or mutation of related IRC genes has been associated with increased recombination rates, elevated sensitivity to DNA-damaging agents, and defects in DNA repair pathways.
For example, yeast cells lacking Irc3 exhibit instability in their mitochondrial genome, suggesting its critical role in maintaining mitochondrial DNA integrity . Researchers studying IRC13 would typically characterize deletion mutants (irc13Δ) through assessments of growth rates under normal and stress conditions, measuring recombination frequencies using reporter systems, and evaluating sensitivity to DNA-damaging agents such as methyl methanesulfonate (MMS), ultraviolet radiation, or hydroxyurea.
Researchers investigating IRC13 structure would typically express and purify the recombinant protein using systems such as E. coli or baculovirus-infected insect cells, followed by structural determination through X-ray crystallography, cryo-electron microscopy, or NMR spectroscopy. Understanding the structural features of IRC13 would provide critical insights into its substrate specificity, potential binding partners, and mechanistic details of its biochemical activities in DNA metabolism pathways.
DNA repair and recombination pathways in Saccharomyces cerevisiae involve complex networks of protein interactions that respond to various forms of genomic stress. While specific information about IRC13's role in these pathways is limited in the provided literature, related IRC proteins have been implicated in multiple DNA metabolism processes.
For instance, in double-strand break (DSB) repair pathways, proteins like Rad51 form nucleoprotein filaments on single-stranded DNA that search for homologous sequences, a critical step in homologous recombination . The homologous recombination pathway in yeast involves multiple steps, including end resection, strand invasion, and resolution of recombination intermediates, often through mechanisms such as the double Holliday junction (dHJ) pathway or synthesis-dependent strand annealing (SDSA) .
Researchers studying IRC13's potential involvement in these pathways would typically employ techniques such as chromatin immunoprecipitation (ChIP), yeast two-hybrid assays, or co-immunoprecipitation experiments to identify physical interactions with known components of DNA repair and recombination machinery. Genetic interaction studies, including synthetic lethality screens or epistasis analyses, would also provide valuable insights into the functional relationships between IRC13 and established DNA repair factors.
DNA helicases are mechanochemical enzymes that couple NTP hydrolysis with the unwinding of DNA or RNA, playing crucial roles in virtually all aspects of nucleic acid metabolism . Superfamily II helicases, to which Irc3 belongs, are typically moderately processive or distributive enzymes that can translocate along DNA as monomers .
To characterize the ATP-dependent activities of IRC13 or similar proteins, researchers would typically perform in vitro assays measuring ATP hydrolysis rates using purified recombinant protein and various DNA substrates. DNA unwinding assays using labeled oligonucleotide substrates with different structures (such as forks, Holliday junctions, or D-loops) would reveal substrate preferences and unwinding efficiencies. Such biochemical characterizations would position IRC13 within the broader context of DNA helicases and provide insights into its specific functions in DNA metabolism.
For recombinant expression of yeast proteins like IRC13, bacterial expression systems using E. coli strains optimized for eukaryotic protein expression (such as BL21(DE3) Rosetta or ArcticExpress) often serve as the first-line approach. Expression conditions typically require optimization of parameters including temperature (often lowered to 16-18°C to improve folding), IPTG concentration for induction, and duration of expression. Solubility-enhancing fusion tags such as MBP (maltose-binding protein), SUMO, or GST (glutathione S-transferase) may improve yield and folding of the recombinant protein.
Purification strategies generally involve affinity chromatography (using the fusion tag), followed by ion-exchange and size-exclusion chromatography to achieve high purity. For proteins like helicases that interact with nucleic acids, additional purification steps including heparin affinity chromatography may be beneficial. Activity assays, such as ATPase assays or DNA binding studies, should be performed throughout purification to monitor retention of enzymatic activity.
The choice of DNA substrates for studying IRC13's biochemical activities would depend on its presumed functions, which might be inferred from related proteins. Based on studies of Irc3, which shows preference for unwinding the nascent lagging strand at replication forks and establishes strong contacts at DNA branching points , researchers studying IRC13 might consider various branched DNA structures.
A comprehensive substrate panel would typically include:
Simple duplexes with varying lengths and sequences
Forked structures mimicking replication forks
D-loop structures resembling recombination intermediates
Holliday junctions representing recombination crossover points
Bubble structures mimicking transcription or replication bubbles
3' or 5' flap structures
These substrates would be constructed using synthetic oligonucleotides, with one or more strands typically labeled with fluorescent dyes or radioactive isotopes for detection in various assays. Binding affinities could be determined using electrophoretic mobility shift assays (EMSAs) or fluorescence anisotropy, while unwinding activities could be assessed using strand displacement assays.
Studying protein-protein interactions in vivo requires techniques that can capture physiologically relevant associations within the cellular context. For investigating IRC13's interactions with DNA repair proteins in Saccharomyces cerevisiae, researchers have several methodological options.
Proximity-based approaches include bimolecular fluorescence complementation (BiFC), where potential interacting proteins are fused to complementary fragments of a fluorescent protein that reconstitutes fluorescence when brought into proximity. Förster resonance energy transfer (FRET) techniques can similarly detect protein interactions by measuring energy transfer between fluorophores attached to potential interaction partners.
Affinity purification coupled with mass spectrometry (AP-MS) provides a broader view of protein interaction networks. This approach typically involves expressing tagged IRC13 in yeast, followed by affinity purification under conditions that preserve native interactions, and identification of co-purifying proteins by mass spectrometry. Crosslinking approaches may help capture transient interactions that occur during dynamic processes like DNA repair.
Genetic interaction studies, including synthetic lethality screens or epistasis analyses with known DNA repair factors, can reveal functional relationships that complement physical interaction data. The combination of these approaches would provide a comprehensive view of IRC13's integration within the broader DNA repair network.
Differentiating between direct and indirect effects in genetic interaction studies presents a significant challenge, particularly when studying proteins involved in complex processes like DNA metabolism. When analyzing phenotypes of IRC13 mutants or genetic interactions between IRC13 and other genes, researchers should implement several complementary approaches to distinguish direct from indirect effects.
Biochemical validation of physical interactions is crucial for establishing direct relationships. If IRC13 shows a genetic interaction with another protein, demonstrating direct physical interaction through methods like co-immunoprecipitation or in vitro binding assays with purified proteins provides stronger evidence for a direct functional relationship. Time-resolved studies, where the sequence of events following DNA damage is mapped, can also help distinguish primary from secondary effects in the cellular response.
Systematic controls including unrelated proteins that affect similar processes and careful phenotypic characterization under various conditions help distinguish specific from general effects. The integration of genetic interaction data with other data types, including gene expression profiles, protein localization patterns, and biochemical activities, provides a more robust basis for distinguishing direct from indirect relationships.
The analysis of recombination frequency data requires statistical approaches that account for the specific characteristics of recombination assays, including their typically non-normal distribution and potential for outliers. While the provided literature doesn't specifically address statistical methods for IRC13 studies, established approaches for recombination data analysis are applicable.
For recombination assays measuring rare events (such as mitotic recombination between homologous chromosomes), where data often follow a Poisson distribution, researchers should consider Poisson regression models rather than standard parametric tests like t-tests. For comparing recombination frequencies between wildtype and mutant strains, non-parametric tests such as the Mann-Whitney U test may be more appropriate than parametric alternatives when data violate normality assumptions.
Fluctuation analysis, based on the Luria-Delbrück distribution, is particularly valuable for distinguishing between increases in recombination rate versus survival of recombination events. This approach involves multiple independent cultures and can determine whether observed differences represent genuine changes in the recombination process itself. For studies examining recombination across multiple genetic backgrounds or conditions, more complex statistical frameworks including ANOVA with appropriate post-hoc tests or mixed-effects models may be necessary.
Regardless of the specific statistical test, researchers should report effect sizes along with p-values to communicate the magnitude of differences in recombination frequencies, and employ multiple testing corrections (such as Bonferroni or false discovery rate methods) when evaluating recombination across multiple loci or conditions.
Contradictions between in vitro biochemical data and in vivo phenotypic observations are common in molecular biology research and require careful interpretation. These discrepancies often reveal important aspects of biological complexity rather than experimental failures. When facing such contradictions in IRC13 studies, researchers should consider several explanatory frameworks.
Biological context differences represent a primary explanation, as in vitro systems lack the complex regulatory networks, spatial organizations, and competing processes present in living cells. Proteins that show strong activity in purified systems may be regulated, compartmentalized, or competed against in vivo. Researchers should consider whether the in vitro conditions adequately reflect the cellular environment where IRC13 functions, including salt concentrations, macromolecular crowding, and the presence of relevant cofactors.
Technical limitations in either approach may explain contradictions. In vitro assays might employ non-physiological substrate concentrations or lack critical cofactors, while in vivo studies might be complicated by redundant pathways that mask phenotypes or by secondary effects unrelated to IRC13's primary function. Experimental validation using complementary approaches, such as structure-function studies where specific biochemical activities are selectively disrupted and the consequences assessed in vivo, can help resolve such contradictions.
Temporal and spatial considerations are also crucial, as the timing and localization of protein activities in vivo may not be captured in biochemical assays. For instance, IRC13 might be active only during specific cell cycle phases or in response to particular damages, contexts that may not be reflected in standard biochemical assays. Time-resolved in vivo studies and conditional mutations can help address these temporal aspects.
CRISPR-Cas9 technology offers unprecedented precision for genetic manipulation, providing powerful approaches for investigating IRC13 function in Saccharomyces cerevisiae. Unlike traditional gene deletion methods that completely remove gene function, CRISPR-Cas9 enables more nuanced genetic modifications that can reveal specific aspects of protein function.
Endogenous tagging at the IRC13 locus allows visualization or purification of the protein expressed at physiological levels from its native genomic context. This approach avoids artifacts associated with overexpression systems and enables techniques such as chromatin immunoprecipitation sequencing (ChIP-seq) to identify genomic binding sites or proximity-based labeling to discover protein interaction partners in their natural cellular environment.
Base editing and prime editing technologies, refinements of CRISPR-Cas9, permit installation of specific mutations without double-strand breaks or donor templates, reducing potential confounding effects from the DNA repair process itself—particularly important when studying proteins involved in DNA metabolism like IRC13.
High-throughput genetic interaction mapping has transformed our understanding of functional relationships between genes and provides powerful approaches for positioning IRC13 within the broader cellular network. Synthetic genetic array (SGA) technology, which systematically creates double mutants by crossing an IRC13 deletion strain with an array of other yeast deletion strains, can reveal both aggravating interactions (where the double mutant is sicker than expected from individual mutations) and alleviating interactions (where the double mutant is healthier than expected).
The pattern of genetic interactions, or "genetic interaction signature," can place IRC13 within a functional framework even without detailed biochemical characterization. Proteins with similar genetic interaction signatures typically function in related pathways or complexes, allowing researchers to infer IRC13's function through guilt by association. Quantitative analysis of these interactions can further distinguish between core pathway components and regulatory factors based on the strength and pattern of interactions.
Condition-specific genetic interaction mapping, where screens are performed under different stresses (such as DNA-damaging agents or replication inhibitors), can reveal context-dependent functions of IRC13. This approach is particularly valuable for proteins involved in stress responses or DNA repair pathways, as some functions may only become essential under specific challenging conditions.
Integration of genetic interaction data with other high-throughput datasets, including physical interaction maps, gene expression profiles, and protein localization data, provides a multi-dimensional view of IRC13's cellular role. Network analysis approaches, such as clustering algorithms or network propagation methods, can then identify functional modules and position IRC13 within the broader cellular organization.
Single-molecule techniques represent powerful approaches for understanding the mechanistic details of proteins involved in DNA metabolism, offering insights not accessible through bulk biochemical assays. For proteins like IRC13, which may function in complex DNA transactions similar to the characterized Irc3 helicase , single-molecule methods can reveal dynamic behaviors and heterogeneity masked in ensemble measurements.
Single-molecule FRET (smFRET) can directly visualize conformational changes in IRC13 during its catalytic cycle by measuring distance changes between fluorophores attached to different domains of the protein. This approach can reveal whether IRC13 undergoes large conformational changes during ATP binding and hydrolysis, and how these changes are coupled to DNA substrate recognition and processing. Similar approaches can monitor DNA substrate dynamics during IRC13 activity, providing insights into the mechanical aspects of its function.
Optical or magnetic tweezers experiments can measure the force generated by IRC13 during DNA unwinding or translocation, revealing its mechanical properties. These approaches can determine whether IRC13 functions as a processive enzyme that remains bound to its substrate through multiple catalytic cycles, or as a distributive enzyme that dissociates after each cycle. The effect of applied force on IRC13's activity can reveal mechanistic details about how it couples ATP hydrolysis to mechanical work on DNA substrates.
DNA curtain assays, where DNA molecules are aligned and anchored to a surface for real-time visualization of protein binding and movement, can reveal the dynamics of IRC13's interaction with DNA substrates. Combined with multi-color imaging of other DNA repair proteins, this approach can visualize the choreography of repair complexes and determine IRC13's temporal and spatial relationship with other pathway components.