Recombinant Saccharomyces cerevisiae Putative maintenance of telomere capping protein 7 (MTC7)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MTC7; YEL033W; SYGP-ORF22; Maintenance of telomere capping protein 7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
MTC7
Target Protein Sequence
MKKEKKTPTPLPSHHVLFAEPGFFLCNFFFVLLKHTQINPFFYFLFILLFIIYIAIIYFV FIRISHFSFSLCRQCNSLGRMIFMCAYLPAASSRSVANPALPPQKKKKKKKKGTLRTGEV EEQAKGNISFDLCGKQNFQ
Uniprot No.

Target Background

Function

Putative involvement in telomere capping.

Database Links

KEGG: sce:YEL033W

STRING: 4932.YEL033W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is MTC7 and what is its role in telomere biology?

MTC7 (Maintenance of Telomere Capping protein 7) is a putative protein in Saccharomyces cerevisiae that is believed to play a role in maintaining telomere capping structures . Telomere capping refers to the protective structures at chromosome ends that prevent them from being recognized as DNA breaks. In S. cerevisiae, telomere maintenance has been extensively studied, with various genes involved in this process identified primarily on a gene-by-gene basis . While the specific molecular mechanisms of MTC7 are still being elucidated, it likely contributes to genomic stability by ensuring proper telomere protection.

How does S. cerevisiae serve as a model organism for studying telomere biology?

S. cerevisiae (budding yeast) serves as an excellent model for telomere biology studies due to several advantages:

  • It possesses a relatively small genome of approximately 6000 genes, which are well-defined with over 80% functionally characterized .

  • It shows high functional conservation with the human genome, with evolutionary conservation extending to approximately 1000 human disease genes .

  • Comprehensive mutant collections are available, including complete gene deletion libraries of non-essential genes, facilitating genome-wide screens for telomere-related functions .

  • Telomere biology in yeast shares fundamental mechanisms with humans while offering simplified experimental systems .

Researchers can leverage these advantages by using techniques such as synthetic genetic array (SGA) approaches to systematically study genes involved in telomere maintenance and subtelomeric silencing .

What are the main experimental approaches for studying MTC7 function?

The study of MTC7 function can employ several methodological approaches:

  • Gene deletion studies: Creating MTC7 knockout strains to observe phenotypic changes, particularly in telomere structure and function .

  • Reporter gene assays: Integrating reporter genes (such as URA3-GFP dual reporters) near telomeres to quantitatively measure subtelomeric silencing effects and how MTC7 might influence them .

  • Recombinant protein expression: Using commercially available recombinant MTC7 protein for in vitro binding studies and biochemical characterization .

  • High-throughput screens: Implementing genome-wide screens to identify genetic interactions with MTC7, similar to approaches used for other telomere-related genes .

These approaches can be combined with advanced microscopy techniques to visualize telomere structures and potential telomere dysfunction induced by MTC7 perturbation.

How does MTC7 interact with other telomere maintenance proteins in S. cerevisiae?

While specific MTC7 interaction data is limited in the provided search results, we can draw insights from general telomere biology in yeast:

MTC7 likely functions within a broader network of telomere maintenance proteins. In yeast, subtelomeric silencing factors have been identified through comprehensive genetic screens, revealing that telomere biology involves multiple interconnected pathways . A genome-wide screen for subtelomeric silencing factors identified proteins related to chromatin conformation that affect telomere function .

Potential MTC7 interactions may be investigated through:

  • Protein-protein interaction studies using techniques such as co-immunoprecipitation or yeast two-hybrid assays

  • Genetic interaction studies examining synthetic lethality or enhancement between MTC7 and other telomere-related genes

  • Chromatin immunoprecipitation to determine MTC7's physical association with telomeric regions

These approaches would help establish MTC7's position within the telomere maintenance protein network.

What phenotypes are associated with MTC7 dysfunction in yeast cells?

Based on our understanding of telomere biology, MTC7 dysfunction would likely manifest in several observable phenotypes:

Phenotype CategoryExpected Observations in MTC7 MutantsDetection Methods
Telomere StructureAltered telomere length; Telomere uncappingSouthern blotting; Telomere restriction fragment analysis
Genomic StabilityIncreased chromosomal fusions; Anaphase bridgesFluorescence microscopy; Pulse-field gel electrophoresis
Cell CycleGrowth defects; Cell cycle arrestGrowth curve analysis; Flow cytometry
DNA Damage ResponseIncreased telomere dysfunction-induced foci (TIFs)Immunofluorescence of DNA damage markers
Gene ExpressionChanges in subtelomeric gene expressionRNA-seq; Reporter gene assays

The specific intensity of these phenotypes would depend on whether MTC7 functions redundantly with other telomere maintenance proteins or has a unique, non-redundant role .

How do experimental conditions affect recombinant MTC7 protein stability and function?

When working with recombinant MTC7 protein , several experimental conditions may affect its stability and functionality:

  • Buffer composition: pH, salt concentration, and presence of stabilizing agents can significantly impact protein folding and activity

  • Temperature: Storage and experimental temperatures must be optimized to maintain native conformation

  • Freeze-thaw cycles: Repeated freezing and thawing may cause protein denaturation and loss of function

  • Cofactor requirements: Like many telomere-associated proteins, MTC7 may require specific cofactors (e.g., metal ions or nucleotides) for optimal activity

  • Post-translational modifications: Expression systems may not recapitulate the native post-translational modifications present in yeast

To address these concerns, researchers should:

  • Perform stability assays under varying conditions

  • Include appropriate controls to verify protein activity

  • Consider using freshly prepared protein for critical experiments

  • Document and standardize storage and handling procedures to ensure reproducibility

What are the molecular mechanisms by which MTC7 contributes to telomere capping?

The specific molecular mechanisms of MTC7's contribution to telomere capping remain to be fully elucidated, but several hypothetical mechanisms can be proposed based on known telomere biology:

  • Direct DNA binding: MTC7 may directly bind to telomeric DNA sequences or structures (e.g., G-quadruplexes or T-loops) to stabilize telomere ends

  • Protein complex assembly: MTC7 might function as a scaffold or regulatory component in telomere-associated protein complexes

  • Chromatin modification: MTC7 could recruit or regulate chromatin-modifying enzymes that establish heterochromatin at telomeres

  • DNA damage response modulation: MTC7 might suppress inappropriate activation of DNA damage response pathways at telomere ends

These mechanisms could be investigated using:

  • DNA-protein binding assays

  • Structural biology approaches (X-ray crystallography, cryo-EM)

  • Chromatin immunoprecipitation followed by sequencing (ChIP-seq)

  • Genetic epistasis experiments with known telomere protection factors

Understanding these mechanisms would provide insights into telomere protection across species, as telomere capping is evolutionarily conserved .

How does the relationship between telomere capping and cellular signaling pathways relate to MTC7 function?

Research in mammalian systems has revealed a mutually reinforcing relationship between telomere capping and signaling pathways such as Wnt signaling . Although direct evidence for MTC7's involvement in such relationships is not provided in the search results, this represents a frontier area for investigation:

In mice lacking telomerase, telomere dysfunction leads to downregulation of Wnt pathway genes, while activation of Wnt signaling can improve telomere capping independent of telomerase activity . This suggests that cellular signaling pathways can influence telomere protection through non-canonical mechanisms.

To explore whether MTC7 participates in similar relationships in yeast:

  • Researchers could investigate changes in MTC7 expression or function in response to alterations in yeast signaling pathways

  • Conversely, they could examine the impact of MTC7 perturbation on key signaling pathways

  • Genetic or pharmacological modulation of candidate pathways could be tested for their ability to rescue MTC7 mutant phenotypes

  • Phosphoproteomic analysis might reveal whether MTC7 is post-translationally modified in response to signaling events

Such studies would bridge fundamental telomere biology with broader cellular regulatory networks.

What genomic approaches can identify the full spectrum of MTC7 genetic interactions?

Comprehensive genomic approaches to map MTC7 genetic interactions could include:

  • Synthetic Genetic Array (SGA) Analysis: Systematically creating double mutants between MTC7 and other yeast genes to identify synthetic lethality or genetic suppression . This approach has been successfully employed for other telomere-related genes.

  • Quantitative subtelomeric reporter screens: Utilizing dual reporter systems (like URA3-GFP) integrated at subtelomeric loci to quantify the effects of MTC7 mutations in combination with other genetic perturbations .

  • RNA-seq of MTC7 mutants: Transcriptome analysis to identify genes whose expression changes in response to MTC7 dysfunction, potentially revealing regulatory networks.

  • Decreased abundance by mRNA Perturbation (DAmP): For studying MTC7 if it proves to be an essential gene, this technique reduces gene expression without complete deletion .

  • Chromatin landscape mapping: Using techniques like ATAC-seq or ChIP-seq to understand how MTC7 affects chromatin structure at telomeres and throughout the genome.

A sample experimental design for an SGA approach would include:

StepProcedureExpected Outcome
1Create MTC7 deletion or DAmP strain with selectable markerQuery strain for crossing
2Cross with yeast deletion library (~4,500 strains)Diploid hybrids
3Induce sporulation and select haploid double mutantsArray of MTC7 double mutants
4Score growth phenotypes and telomere-related readoutsIdentification of genetic interactions
5Validate hits with secondary assaysConfirmation of true interactions

This approach would generate a comprehensive genetic interaction map centered on MTC7 .

What are the optimal conditions for expressing and purifying recombinant MTC7 protein?

When expressing and purifying recombinant MTC7 protein, researchers should consider:

  • Expression system selection:

    • Bacterial systems (E. coli): Simple and cost-effective but may lack appropriate post-translational modifications

    • Yeast systems (S. cerevisiae): Provides native folding environment but lower yields

    • Insect cell systems: Balance between yield and post-translational modifications

  • Purification strategy:

    • Affinity tags: His-tag, GST, or MBP fusion proteins facilitate purification while potentially maintaining function

    • Chromatography sequence: Typically involving affinity, ion exchange, and size exclusion steps

    • Buffer optimization: Critical for maintaining stability during purification

  • Quality control assessments:

    • SDS-PAGE and Western blotting for purity and identity verification

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to assess proper folding

    • Functional assays to confirm biological activity

Commercial sources currently offer purified recombinant MTC7 protein , but researchers requiring specific modifications or constructs would benefit from establishing their own purification protocols tailored to their experimental needs.

How can researchers differentiate between direct and indirect effects of MTC7 on telomere function?

Distinguishing direct from indirect effects of MTC7 on telomere function requires multiple complementary approaches:

  • Direct binding assays:

    • Electrophoretic mobility shift assays (EMSA) with telomeric DNA sequences

    • Surface plasmon resonance to measure binding kinetics

    • Microscale thermophoresis for quantitative binding analysis

  • In vivo proximity analysis:

    • ChIP experiments to determine if MTC7 physically associates with telomeres

    • Proximity ligation assays to visualize MTC7-telomere interactions

    • CRISPR-based tagging for live-cell imaging of MTC7 localization

  • Temporal resolution studies:

    • Inducible MTC7 depletion systems to monitor immediate versus delayed effects

    • Time-course experiments following MTC7 perturbation

    • Single-cell analysis to capture heterogeneity in response timing

  • Domain mapping and mutagenesis:

    • Structure-function analysis of MTC7 domains

    • Point mutations in potential DNA-binding or protein interaction surfaces

    • Chimeric protein constructs to isolate functional domains

By integrating these approaches, researchers can build a comprehensive understanding of how MTC7 influences telomere biology, distinguishing its primary functions from downstream consequences.

What controls should be included when studying MTC7 function in telomere maintenance assays?

Robust experimental design for studying MTC7 function should include the following controls:

Control TypeSpecific ControlsRationale
Genetic ControlsWild-type strainBaseline for normal telomere function
Known telomere maintenance mutants (e.g., in telomerase components)Positive controls for telomere dysfunction
Complementation with wild-type MTC7Confirms phenotype specificity
Technical ControlsMultiple telomere length measurement methodsGuards against method-specific artifacts
Analysis of multiple independent clonesAccounts for clone-to-clone variation
Time-course measurementsDistinguishes acute from progressive effects
Specificity ControlsAnalysis of non-telomeric regionsConfirms telomere specificity
Examination of multiple telomeresEnsures findings aren't telomere-specific
Structure-function mutations in MTC7Links specific domains to observed functions
Biological ReplicatesIndependent experimentsEnsures reproducibility
Different growth conditionsTests environmental influences
Different genetic backgroundsTests strain-specificity

How can researchers integrate MTC7 findings with broader telomere biology knowledge?

Integrating MTC7-specific findings with the broader telomere biology field presents several challenges and opportunities:

  • Comparative genomics approach:

    • Align MTC7 with potential orthologs in other species

    • Examine conservation of functional domains across evolutionary distance

    • Compare telomere maintenance mechanisms between yeast and mammals

  • Network biology integration:

    • Place MTC7 within known telomere protein interaction networks

    • Identify central nodes that connect MTC7 function to other cellular processes

    • Use graph theory to predict functional relationships

  • Multi-omics data integration:

    • Combine genomic, transcriptomic, and proteomic data related to MTC7

    • Apply machine learning approaches to identify patterns across datasets

    • Develop predictive models of telomere maintenance incorporating MTC7

Researchers should be aware that telomere biology involves complex interactions between multiple pathways. For example, studies in mice have shown a mutual reinforcement between telomere capping and Wnt signaling , suggesting that telomere maintenance is integrated with broader cellular signaling networks. Similar interconnections may exist for MTC7 in yeast.

What are common pitfalls in interpreting telomere phenotypes in MTC7 studies?

Several pitfalls can complicate the interpretation of telomere phenotypes in MTC7 studies:

  • Phenotypic lag effects: Telomere dysfunction phenotypes often develop progressively over multiple cell divisions, requiring long-term experiments to fully capture

  • Compensatory adaptations: Cells may develop compensatory mechanisms to adapt to MTC7 perturbation, masking primary effects

  • Background strain variations: Different yeast strains have different baseline telomere lengths and maintenance mechanisms, necessitating strain standardization

  • Telomere position effects: The impact of MTC7 dysfunction may vary across different telomeres, requiring examination of multiple chromosome ends

  • Context-dependent functions: MTC7's role may depend on environmental conditions, cellular stress, or the presence of other genetic variations

  • Technical variation in telomere assays: Methods for measuring telomere length and function have inherent variability and limitations

To address these pitfalls, researchers should:

  • Include appropriate time-course experiments

  • Use multiple methods to assess telomere phenotypes

  • Carefully document strain backgrounds

  • Examine multiple independent telomeres

  • Test under various environmental conditions

  • Include technical replicates and statistical analysis

How might MTC7 function interact with other cellular pathways beyond direct telomere maintenance?

Research on telomere biology in other systems suggests that telomere maintenance proteins often have functions beyond direct telomere protection. For MTC7, potential interactions with other cellular pathways might include:

  • DNA damage response integration: Telomere dysfunction triggers DNA damage responses, and MTC7 may modulate these pathways. Studies in mice have shown that telomere dysfunction leads to increased telomere-dysfunction-induced foci (TIFs) .

  • Cell cycle regulation: Telomere status influences cell cycle progression, and MTC7 could participate in checkpoint signaling under telomere stress conditions.

  • Metabolic connections: Research has shown that metabolic state can influence telomere biology. For example, lithium treatment (which inhibits glycogen synthase kinase 3) can rescue telomere capping defects in telomerase-deficient mice .

  • Nuclear architecture: Telomeres contribute to nuclear organization, and MTC7 might influence chromatin structure beyond telomeres.

  • Stress response pathways: Environmental stressors affect telomere maintenance, and MTC7 could function within stress response networks.

Examining these potential connections requires integrative approaches:

  • Epistasis experiments with genes in candidate pathways

  • Phenotypic analysis under various stress conditions

  • Protein localization studies during different cellular states

  • Metabolomic analysis in MTC7 mutants

Understanding these broader interactions would provide a more complete picture of MTC7's biological role.

What are the key unanswered questions about MTC7 function in telomere biology?

Despite advances in understanding telomere biology, several key questions about MTC7 remain unanswered:

  • What is the precise molecular mechanism by which MTC7 contributes to telomere capping?

  • Does MTC7 function independently or as part of a larger protein complex?

  • How is MTC7 expression and function regulated during the cell cycle and in response to stress?

  • Are there functional orthologs of MTC7 in mammals, and do they share conserved functions?

  • Could MTC7 be targeted therapeutically in conditions involving telomere dysfunction?

These questions represent important areas for future investigation to fully understand MTC7's role in telomere biology.

How might findings from MTC7 research translate to understanding human telomere biology and disease?

S. cerevisiae has proven valuable as a model organism for understanding fundamental biological processes with relevance to human health . MTC7 research could translate to human biology in several ways:

  • Identification of human orthologs: If human orthologs of MTC7 exist, they could represent novel factors in human telomere biology

  • Conserved mechanisms: Basic mechanisms of telomere protection discovered through MTC7 research might apply to human telomere maintenance

  • Disease insights: Understanding telomere capping mechanisms could provide insights into conditions like dyskeratosis congenita, where telomere maintenance is compromised

  • Therapeutic approaches: Novel telomere protection mechanisms might suggest therapeutic strategies for diseases involving telomere dysfunction

The relationship between telomere capping and signaling pathways, as demonstrated by the mutual reinforcement between telomere capping and Wnt signaling in mice , suggests that telomere biology is integrated with broader cellular regulation. Similar principles may apply to MTC7 function in yeast and potentially to related processes in humans.

What emerging technologies might accelerate MTC7 research in the coming years?

Several emerging technologies promise to accelerate research on MTC7 and telomere biology:

  • CRISPR-based approaches:

    • CRISPRi for tunable gene repression rather than complete deletion

    • Base editing for precise mutation introduction

    • Live-cell imaging of telomeres using CRISPR-based tagging

  • Single-cell technologies:

    • Single-cell RNA-seq to capture cellular heterogeneity in response to MTC7 perturbation

    • Single-cell proteomics to identify protein-level changes

    • Single-cell imaging to track telomere dynamics in real-time

  • Structural biology advances:

    • Cryo-electron microscopy for complex structures

    • Integrative structural biology combining multiple data sources

    • In-cell structural determination techniques

  • Synthetic biology approaches:

    • Reconstituting minimal telomere protection systems

    • Engineering synthetic telomere capping proteins based on MTC7

    • Creating reporter systems for high-throughput screens

  • Computational methods:

    • Machine learning for predicting protein-protein interactions

    • Molecular dynamics simulations of MTC7-telomere interactions

    • Network analysis tools for integrating multi-omics data

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.