Recombinant Saccharomyces cerevisiae Putative meiotic phospholipase SPO1 (SPO1)

Shipped with Ice Packs
In Stock

Description

General Information

Saccharomyces cerevisiae Putative Meiotic Phospholipase SPO1, commonly referred to as SPO1, is a protein crucial for meiosis in yeast . SPO1 exhibits similarity to phospholipase B enzymes and is essential for spindle pole body (SPB) duplication during meiosis but not during mitosis . The protein is required for chromosome segregation and spore formation during meiosis I (MI) and meiosis II (MII) .

Function and Role in Meiosis

SPO1 is induced early in meiosis and remains expressed through ascus formation, indicating its continued requirement for proper SPB function during development . It is involved in SPB morphogenesis at three distinct stages of meiosis: SPB duplication during MI and MII, and spore formation . SPO1 appears to play a regulatory role in SPB function, coordinating meiotic divisions with gamete development .

Protein Structure and Homology

SPO1 is a nuclear protein that shares significant similarity with phospholipase enzymes found in fungi and vertebrates . The protein contains a conserved serine residue within its putative phospholipase active site, which is essential for its meiotic function . Although SPO1 exhibits homology to phospholipase B (PLB) enzymes, it is not anchored to the cell wall via glycosylphosphatidylinositol (GPI) like some other yeast PLB enzymes such as Plb1 and Plb2 .

Genetic Interactions and Signaling Pathways

SPO1 interacts genetically with SPO71, a pleckstrin homology domain protein involved in prospore membrane development . The absence of SPO71 partially rescues the prospore membrane defect caused by the absence of SPO1, suggesting that SPO71 and SPO1 exert antagonistic effects on the developing prospore membrane . SPO1 also interacts physically with Spo23, a protein that regulates phosphatidylinositol synthesis, further supporting the involvement of phosphatidylinositol and its derivatives in SPO1 function .

Phenotype of SPO1 Mutants

Cells lacking SPO1 exhibit several defects during meiosis :

  • Arrest during Meiosis: In a SPO1 null mutant, approximately 75% of cells arrest early at MI SPB duplication, about 20% arrest at MII, and roughly 5% arrest at spore formation .

  • Prospore Membrane Defects: SPO1 is involved in promoting the proper curvature of the prospore membrane . Cells lacking SPO1 can develop abnormally wide prospore membranes .

  • Spore Formation Issues: Although cells lacking SPO1 undergo meiosis, as indicated by the presence of four nuclei within the ascus, spore wall deposition is disrupted .

Phospholipase Activity and Substrates

SPO1 is predicted to encode a phospholipase B homolog, and there is evidence suggesting it acts on phosphatidylinositol (PI) or its phosphorylated derivatives . It has been demonstrated that SPO1 binds relatively strongly to PI(4)P derivatives via an N-terminal lysine-rich fragment that is essential for SPO1 function .

Suppression of SPO1 Deletion

The sporulation defect in spo1 mutants can be partially suppressed by high-copy expression of CWP1, a gene encoding a cell wall protein with a GPI anchor . Two other GPI proteins, Spo19 and Cwp2, can also suppress spo1 deletion, dependent on the level and timing of their expression . This suggests that GPI proteins might substitute for Spo1 by decreasing levels of its potential substrates, such as PI and phosphatidylinositol phosphates (PIPs) .

Role in Prospore Membrane Development

SPO1 is implicated in determining the shape of the prospore membrane, a structure that grows de novo during sporulation to surround the four meiotic products . Cells lacking SPO1 can have abnormally wide prospore membranes, and SPO1 is thought to promote the proper curvature of this membrane .

Relevance to Virulence

Secretion of enzymes, such as phospholipases, has been proposed as a mechanism used by bacteria, parasites, and pathogenic fungi to damage host cells . While SPO1 is primarily studied in the context of meiosis in S. cerevisiae, phospholipases, in general, have been included among the virulence factors that damage host cells .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
SPO1; YNL012W; N2858; Putative meiotic phospholipase SPO1; Sporulation-specific protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-631
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SPO1
Target Protein Sequence
TAPFQVQCPSSPLIREAKHELCPEETLYLKKKKIKTKNKLIQFLKSLTEAKFSSKFYKRV LKDPPKIGIAISGGGYRSMLVGTGFISQMNDYGLFEYSDYIAGLSGGSWILMDLVVQNFE VKSLLQEWDLEEDLLLGIPEFDISEEEIVTNAKKEYNDNDLKMKKRQGGSLITSSSNFYE QIEEIMNSIEEIPEDYMITKRNLNPLARLKKIFFPNNTFTGTDAKIETFKKVLDFYKSLH LKIKPKKMEGFQISFTDYWGKAIVQRLKKNFDDDPNHSFSFSKLVNSSKKFKECSVPIPI FVANCKNGLLSNVIFEFTPFEFGSWENILRLFVKLPYLGSKIVSGKAEKCINNFDDLGFI TATSSSIFNNVLIFIWNLASQSSREAMKALNMVMGIFGLGKEEIFSISKDSSRLETDYAV YQPNPFYLYPEKDNVLTNKNHLYLVDGGEDGENIPLRTLVIPERELDVIFVLDSSSDIDN YPNGSKLKRIFEKLDEENVHYQFPNNVKTFTHPIVIGCNATKRTGHDSFLPIIIYHANAN HGNASNTSTFKITYNQSEVSSMLPTGRGVFSNDYDLYYKNCLGCILTKRTMDRLPRKKKF SPFCLQCFKDYCYS
Uniprot No.

Target Background

Function
This protein regulates spindle pole duplication during meiosis I, but not mitosis. It is essential for meiosis I and II chromosome segregation and spore formation. It binds phosphatidylinositol (4)P mono- and polyphosphates.
Gene References Into Functions
  1. A Spo1-dependent, meiosis-specific signaling pathway is required for progression through meiosis I, meiosis II, and spore formation by regulating the spindle pole body. PMID: 17179081
Database Links

KEGG: sce:YNL012W

STRING: 4932.YNL012W

Protein Families
Lysophospholipase family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Nucleus membrane; Single-pass membrane protein.

Q&A

What is SPO1 and what is its primary function in Saccharomyces cerevisiae?

SPO1 is a gene that encodes an early meiotic transcript specifying a nuclear protein with extensive similarity to fungal and vertebrate phospholipase enzymes. Its primary function relates to meiotic division and sporulation in Saccharomyces cerevisiae. SPO1 is dispensable for vegetative growth, premeiotic DNA synthesis, and meiotic recombination, but is required for successful Meiosis I (MI) and Meiosis II (MII) chromosome segregation and spore formation . Specifically, SPO1 is the only known gene required for spindle pole body (SPB) duplication in meiosis but not in mitosis, suggesting it plays a regulatory rather than structural role in SPB function .

How is SPO1 structurally characterized and what domains are important for its function?

SPO1 contains conserved domains characteristic of phospholipase B enzymes. The protein possesses a putative phospholipase active site, which includes a conserved serine residue that is critical for function. Mutations affecting this residue result in loss of SPO1 function . Additionally, the temperature-sensitive mutation spo1-1 resides near this active site region and also results in functional loss . While the exact three-dimensional structure has not been fully elucidated in the provided search results, the functional importance of the phospholipase domain suggests that SPO1's enzymatic activity is essential to its role in meiotic progression.

What is the expression pattern of SPO1 during the yeast life cycle?

SPO1 encodes an early meiotic transcript, meaning its expression is upregulated during the early stages of meiosis . This expression pattern is consistent with its role in meiotic spindle pole body duplication. SPO1 expression is likely regulated as part of the transcriptional cascade that controls sporulation in Saccharomyces cerevisiae, which is initiated by the master regulator Ime1 . Early meiotic genes typically contain URS1 regulatory elements in their promoters that are bound by the Ume6 protein during vegetative growth (repressing expression) and are activated when Ime1 interacts with Ume6 during meiotic induction .

How does SPO1 contribute to spindle pole body duplication during meiosis?

SPO1 is uniquely required for spindle pole body (SPB) duplication during meiosis but not during mitosis . In SPO1 null mutants, approximately 75% of cells arrest early at MI spindle pole body duplication . SPO1's phospholipase activity is likely involved in modifying membrane components necessary for proper SPB duplication specifically during meiosis. SPO1 may function to coordinate nuclear division with membrane remodeling events that are unique to meiosis and sporulation. The protein appears to participate in a novel meiotic pathway that functions through the SPB to coordinate nuclear division with spore development .

What phenotypes are observed in SPO1 mutants during sporulation?

In a complete SPO1 deletion (null mutant), cells display multiple arrest points during meiosis and spore formation:

  • Approximately 75% of cells arrest early at Meiosis I spindle pole body duplication

  • Approximately 20% arrest at Meiosis II

  • Approximately 5% arrest at spore formation

This distribution of arrest points suggests that SPO1 functions at multiple stages of meiosis and sporulation. The transcriptional program in spo1 null mutants is similar to wild-type cells early in meiosis but becomes significantly delayed at later stages of sporulation . The fact that some cells progress beyond the first arrest point suggests the existence of functions partially redundant to SPO1 .

How does SPO1 integrate with the broader regulatory network that controls sporulation?

SPO1 appears to function within the larger transcriptional cascade that controls sporulation in Saccharomyces cerevisiae. Sporulation is controlled by a sequential activation of gene expression waves, including early, middle, mid-late, and late genes . While the search results don't explicitly place SPO1 within this cascade, its expression as an early meiotic transcript suggests it is likely regulated as part of the early gene set controlled by Ime1 and Ume6 . SPO1's pleiotropic effects on MII, late gene expression, and spore formation indicate that it may function as a regulatory node that influences multiple downstream pathways in the sporulation process .

What methods are effective for analyzing SPO1 gene function and phenotypes?

Several experimental approaches can be employed to analyze SPO1 function:

  • Genetic manipulation: Creating point mutations in the conserved serine residue in the putative phospholipase active site to test the importance of enzymatic activity .

  • Temperature-sensitive mutants: Utilizing the spo1-1 temperature-sensitive mutation to conditionally inactivate SPO1 function .

  • Complete gene deletion: Analyzing the phenotypes of SPO1 null mutants to determine the necessity of the gene for various processes .

  • Transcriptional profiling: Comparing gene expression patterns between wild-type and spo1 mutant cells during sporulation to identify downstream effects .

  • Random Spore Analysis (RSA): A technique that can be used to purify haploid spores following specific crosses, which is particularly relevant for studying genes involved in sporulation like SPO1 .

How can Random Spore Analysis (RSA) be optimized for studying SPO1 and other sporulation genes?

Random Spore Analysis (RSA) is a classic method in yeast genetics that allows high-throughput purification of recombinant haploid spores following specific crosses . For optimal RSA when studying SPO1:

  • Heat shock treatment: Recent research has shown that heat shock can significantly improve RSA in diverse Saccharomyces cerevisiae strains. Different strains require specific combinations of temperature and incubation time for optimal results .

  • Strain considerations: The effectiveness of heat shock treatments varies by strain. For example, European wine strains (DBVPG6765), Japanese sake strains (Y12), West African palm wine strains (DBVPG6044), and North American oak soil strains (YPS128) all respond differently to heat treatment conditions .

  • Protocol optimization: A modified RSA protocol incorporating heat shock includes:

    • Inducing sporulation under standard conditions

    • Applying strain-specific heat shock parameters to selectively kill vegetative cells

    • Disrupting ascus walls to release haploid spores

    • Collecting and plating spores for analysis

Heat shock treatment leads to increased genetic diversity among surviving cells, potentially enhancing the utility of RSA for genetic studies .

What methods are effective for visualizing SPO1 protein localization and dynamics during meiosis?

While the search results don't specifically mention visualization techniques for SPO1, standard approaches for studying protein localization and dynamics in yeast during meiosis would include:

  • Fluorescent protein tagging: Creating SPO1-GFP (or other fluorescent tag) fusion proteins to track localization in live cells during meiotic progression.

  • Immunofluorescence microscopy: Using antibodies against SPO1 or epitope-tagged versions to visualize the protein in fixed cells at various meiotic stages.

  • Co-localization studies: Determining spatial relationships between SPO1 and spindle pole body components or other meiotic structures.

  • Time-lapse microscopy: Following SPO1 dynamics throughout the meiotic divisions and sporulation process.

These approaches would need to be validated specifically for SPO1, as its phospholipase activity may make certain tagging strategies more challenging if they interfere with enzymatic function.

What genetic interactions have been identified for SPO1?

Based on the available search results, a key genetic interaction has been identified with CWP1, which encodes a cell wall protein with a glycolipid moiety. CWP1 was recovered as a multicopy suppressor of the spo1 null mutation . This suggests that when CWP1 is overexpressed, it can partially compensate for the loss of SPO1 function, potentially through related lipid-modifying pathways.

The suppression mechanism proposed is that the glycolipid moiety of Cwp1, when modified by other lipases, may substitute for the product(s) of Spo1p lipase activity in meiosis . This indicates a functional relationship between cell wall components and the meiotic processes regulated by SPO1.

How can suppressor screens be designed to identify functional pathways related to SPO1?

A comprehensive suppressor screen for SPO1 could be designed with the following methodology:

  • Multicopy suppressor screen: Transform spo1Δ mutants with a genomic library in a multicopy vector and select for restoration of sporulation ability .

  • Dosage-dependent suppression analysis: Test whether increasing the copy number of potential suppressors correlates with the degree of phenotypic rescue.

  • Chemical suppression: Screen for chemical compounds that rescue spo1 mutant phenotypes, potentially identifying metabolites related to phospholipid pathways.

  • Synthetic genetic array (SGA) analysis: Combine spo1 mutations with systematic gene deletions to identify genes that either enhance or suppress spo1 phenotypes.

  • Targeted candidate approach: Test genes involved in related processes (phospholipid metabolism, membrane dynamics, spindle pole body components) for suppression capability.

These approaches would help establish a comprehensive genetic interaction network centered on SPO1, providing insights into its functional pathways.

What is the significance of CWP1 as a multicopy suppressor of spo1 null mutations?

The identification of CWP1 as a multicopy suppressor of spo1 null mutations provides important insights into the potential mechanism of SPO1 function . CWP1 encodes a cell wall protein with a glycolipid moiety, suggesting a connection between SPO1's phospholipase activity and cell wall/membrane components .

This suppression relationship suggests that:

  • The products of SPO1's enzymatic activity may be related to glycolipid modifications

  • CWP1 overexpression might increase the availability of substrates that can be modified by other lipases to functionally substitute for SPO1 activity

  • SPO1's role in spindle pole body duplication during meiosis may be mediated through membrane/lipid modifications

The proposed model is that when CWP1 is overexpressed, other lipases can modify its glycolipid moiety to substitute for the products normally generated by SPO1 during meiosis . This connection between a cell wall component and a nuclear meiotic process illuminates potential pathways by which SPO1 coordinates nuclear division with spore development.

How can genome sequencing be used to analyze SPO1-dependent recombination events?

Genome sequencing provides powerful tools for analyzing recombination events in SPO1-dependent meiotic processes:

  • High-throughput sequencing of recombinant populations: Genome sequence data from recombinant populations that have undergone Random Spore Analysis (RSA) can reveal patterns of genetic exchange and recombination frequencies .

  • SNP analysis: Single nucleotide polymorphism (SNP) detection across recombinant genomes can be used to map crossover and gene conversion events, providing insights into how SPO1 influences recombination patterns.

  • Comparative analysis with spo1 mutants: Comparing recombination frequencies and patterns between wild-type and spo1 mutant populations can identify specific effects of SPO1 on the meiotic recombination landscape.

  • Sequencing strategies: The generation of genome-wide data from recombinant spores, particularly those that have undergone RSA with heat shock treatment, can provide valuable insights into the genetic diversity of the resulting population .

These approaches can help determine whether SPO1, beyond its role in spindle pole body duplication, also influences meiotic recombination patterns or chromosome segregation fidelity.

What are the methodological challenges in studying phospholipase activity of SPO1 in vitro?

While the search results don't explicitly discuss in vitro studies of SPO1's phospholipase activity, several methodological challenges can be anticipated based on the nature of phospholipase enzymes:

  • Substrate specificity: Determining the precise phospholipid substrates for SPO1 may require testing various lipid compositions relevant to nuclear/SPB membranes.

  • Enzymatic conditions: Establishing optimal conditions (pH, temperature, cofactors) for measuring SPO1 activity in vitro that reflect its in vivo environment.

  • Protein purification: Phospholipases can be challenging to purify in an active form due to their hydrophobic nature and potential membrane association.

  • Activity assays: Developing sensitive and specific assays to detect the products of SPO1-mediated phospholipid hydrolysis.

  • Structure-function studies: Correlating in vitro enzymatic activity with in vivo function through site-directed mutagenesis of key residues like the conserved serine in the active site .

These technical challenges would need to be addressed to definitively characterize SPO1 as a functional phospholipase and determine its specific enzymatic properties.

How can advanced microscopy techniques be used to study the role of SPO1 in spindle pole body dynamics?

Advanced microscopy techniques could provide critical insights into SPO1's role in spindle pole body (SPB) dynamics during meiosis:

  • Super-resolution microscopy: Techniques like structured illumination microscopy (SIM), stimulated emission depletion (STED), or photoactivated localization microscopy (PALM) could resolve SPO1 localization relative to SPB components at nanometer resolution.

  • Correlative light and electron microscopy (CLEM): Combining fluorescence imaging of SPO1 with electron microscopy to visualize ultrastructural changes in SPBs in wild-type versus spo1 mutant cells.

  • Live-cell imaging with quantitative analysis: Following SPB duplication and separation in real-time using fluorescently tagged SPB markers in conjunction with SPO1 visualization.

  • Förster resonance energy transfer (FRET): Detecting potential direct interactions between SPO1 and SPB components or membrane structures.

  • Single-molecule tracking: Following the dynamics of individual SPO1 molecules during meiotic progression to understand its temporal and spatial regulation.

These approaches would help elucidate whether SPO1 directly associates with SPBs, how it influences SPB duplication specifically during meiosis, and the spatial relationship between SPO1's phospholipase activity and SPB structural changes.

How conserved is SPO1 function across different yeast species and other eukaryotes?

While the search results don't provide specific information about SPO1 conservation across species, the fundamental nature of meiosis suggests several comparative aspects could be explored:

  • SPO1 shows extensive similarity to both fungal and vertebrate phospholipase enzymes, indicating evolutionary conservation of its basic enzymatic function .

  • The unique requirement of SPO1 for meiotic but not mitotic SPB duplication suggests a specialized adaptation for sexual reproduction .

  • Comparative genomic analyses could identify SPO1 orthologs in other fungi and potentially in higher eukaryotes to determine if its meiosis-specific function is widely conserved.

  • Functional complementation experiments using SPO1 orthologs from different species could test whether the mechanism of action is conserved despite potential sequence divergence.

Understanding the evolutionary conservation of SPO1 would provide insights into the fundamental requirements for proper meiotic division across eukaryotic lineages.

How do different strains of Saccharomyces cerevisiae vary in SPO1 function and sporulation efficiency?

Different strains of Saccharomyces cerevisiae show significant variation in sporulation efficiency and responses to treatments that affect sporulation. For example:

These strain-specific differences highlight the importance of considering genetic background when studying SPO1 function and designing experiments to analyze sporulation phenotypes.

What can we learn from comparing SPO1 to other phospholipases involved in developmental processes?

Comparing SPO1 to other phospholipases involved in developmental processes could provide valuable insights:

  • SPO1 belongs to the phospholipase B family of enzymes, suggesting potential mechanisms of action similar to other phospholipases involved in membrane remodeling .

  • The search results don't provide direct comparisons to other developmental phospholipases, but such analyses could reveal common themes in how lipid modification influences cellular differentiation processes.

  • Potential comparative studies could examine:

    • The role of phospholipases in membrane dynamics during other developmental transitions

    • Substrate specificity differences between meiosis-specific and general phospholipases

    • Regulatory mechanisms controlling phospholipase activity during cellular differentiation

  • The proposed model for SPO1 function suggests it participates in a novel meiotic pathway coordinating nuclear division with spore development , which could be compared to other systems where phospholipases bridge nuclear and cytoplasmic processes.

Such comparative analyses would help place SPO1 within the broader context of phospholipase-mediated developmental regulation across biological systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.