Recombinant Saccharomyces cerevisiae Putative regulator of rDNA transcription protein 16 (RRT16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
RRT16; YNL105W; N2169; Putative regulator of rDNA transcription protein 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-142
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RRT16
Target Protein Sequence
MSMKSHLELFKQKKSTAYILLTVLFGIGWATLDLPVMVAMNIRPSISMRPIKPYISWLDS LLKPLPFNSAFGTNSTAHVDLREFLLFIGLNTSPCVSETIAIFLVCCFDRSIFIATEYLF LILLPLRGLCHQFCEQKYVETI
Uniprot No.

Target Background

Function

Identified in a screen for mutants exhibiting decreased rDNA transcription levels.

Database Links

STRING: 4932.YNL105W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is RRT16 and what is its function in Saccharomyces cerevisiae?

RRT16 (Regulator of rDNA Transcription 16) is one of fourteen previously uncharacterized genes identified during transposon mutagenesis screens that modulate ribosomal DNA transcription in Saccharomyces cerevisiae. It was discovered among a larger set of 68 different genes that, when mutated, altered expression patterns of a reporter cassette adjacent to rDNA transcription units . RRT16 functions as part of the cellular machinery that regulates RNA Polymerase I (Pol I) transcription in response to nutrient and stress signals. Its specific molecular function likely involves modulation of the transcriptional activity at the rDNA locus, which contains approximately 150-200 head-to-tail repeats of the 9.1-kb rDNA gene on chromosome XII . Based on patterns observed with other rDNA transcription regulators, RRT16 may play a role in determining which fraction of the rDNA genes are actively transcribed, as typically only about 50% of rDNA genes are transcribed in a proliferating yeast cell .

How was RRT16 identified as a regulator of rDNA transcription?

RRT16 was identified through a sophisticated genetic assay developed to detect alterations in transcription from the centromere-proximal rDNA gene of the tandem array in S. cerevisiae. This assay utilized a modified URA3 reporter cassette (mURA3) positioned adjacent to the rDNA gene such that changes in Pol I transcription altered the expression of the reporter . Specifically, reductions in Pol I transcription induced growth on synthetic media lacking uracil, while increases in Pol I transcription induced growth on media containing 5-FOA (5-Fluoroorotic Acid) at 0.2% concentration .

The researchers performed a transposon mutagenesis screen with this reporter strain to identify genes that modulate rDNA transcription. Transformants were selected on SC-leu plates, grown for 3 days, and then replica-plated to SC-leu, SC-leu-ura, and SC-leu+FOA to identify mutants with altered rDNA transcription patterns . The locations of the mTn3 insertions were determined using either a plasmid rescue technique with pRS404 or inverse PCR from genomic DNA, followed by sequencing across the transposon-yeast DNA junction . Through this process, mutations in 68 different genes were identified, including the previously uncharacterized RRT16.

What is the relationship between RRT16 and the RNA Polymerase I transcription complex?

The relationship between RRT16 and RNA Polymerase I (Pol I) transcription complex likely involves regulatory interactions that affect the assembly or activity of Pol I at rDNA promoters. Pol I is a 590 kDa enzyme composed of 14 subunits that is responsible for synthesizing ribosomal RNA . The binding of initiation factor Rrn3 activates Pol I, fostering its recruitment to ribosomal DNA promoters .

Based on knowledge of rDNA transcription regulation, RRT16 may influence the Pol I-Rrn3 complex formation or stability. As shown in other studies, when growth is arrested by nutrient deprivation, cells induce rapid clearance of Pol I-Rrn3 complexes, followed by the assembly of inactive Pol I homodimers . This dual repressive mechanism reverts upon nutrient addition, thus restoring cell growth. RRT16 could potentially function within this regulatory framework, affecting either the association of Rrn3 with Pol I or the transition between active monomeric and inactive dimeric states of Pol I.

What are the recommended protocols for recombinant expression of RRT16?

Based on successful expression protocols for other S. cerevisiae proteins, a recommended approach for recombinant expression of RRT16 would follow similar methodologies to those used for other yeast proteins like Rrd1. The gene should first be amplified by standard PCR and subsequently cloned downstream to a bacteriophage T7 inducible promoter and lac operator in an expression vector such as pET21d(+) . This construct should include a polyhistidine tag to facilitate purification.

Expression can be induced in E. coli BL21(DE3) cells with IPTG, followed by cell harvesting and lysis. Immobilized metal affinity chromatography (IMAC) is recommended for initial purification of the protein to homogeneity, with further confirmation of purity through western blotting . Size exclusion chromatography should be performed to determine oligomeric state and ensure proper folding. Circular dichroism spectroscopy can be used to analyze secondary structure elements, looking for characteristic negative minima at 222 and 208 nm typical of α-helical proteins . Additionally, fluorescence spectroscopy can confirm properly folded tertiary structures under physiological conditions.

What assays can be used to measure RRT16 activity in relation to rDNA transcription?

Several assays can be employed to measure RRT16 activity in relation to rDNA transcription:

  • Reporter Gene Assay: Similar to the assay used in the identification of RRT16, a modified URA3 reporter cassette (mURA3) can be positioned adjacent to the rDNA gene. Changes in Pol I transcription due to RRT16 activity will alter the expression of the reporter, allowing growth on selective media .

  • Chromatin Immunoprecipitation (ChIP): Using antibodies against RRT16 or epitope-tagged versions of the protein, ChIP can determine whether RRT16 associates directly with rDNA chromatin and identify its binding sites.

  • Run-on Transcription Assays: These assays measure the density of Pol I molecules engaged in transcription on rDNA genes, providing direct evidence of RRT16's impact on transcriptional activity.

  • Psoralen Photocrosslinking: This technique distinguishes between active and inactive rDNA genes based on their chromatin structure. Given that only about 50% of rDNA genes are typically transcribed in proliferating yeast cells , this assay can reveal whether RRT16 affects the proportion of active versus inactive rDNA genes.

  • Co-immunoprecipitation (Co-IP): To identify protein-protein interactions involving RRT16, particularly with components of the Pol I machinery or other regulators of rDNA transcription.

How can researchers generate and validate RRT16 mutant strains?

To generate RRT16 mutant strains, researchers should consider the following approaches:

CRISPR-Cas9 Gene Editing:

  • Design guide RNAs targeting the RRT16 gene

  • Include a repair template containing desired mutations or deletion

  • Transform yeast cells with the CRISPR-Cas9 system and repair template

  • Select transformants and verify mutations by sequencing

Homologous Recombination:

  • Create a deletion cassette containing a selectable marker (e.g., KanMX6) flanked by homologous regions upstream and downstream of RRT16

  • Transform yeast cells and select on appropriate media

  • Confirm gene replacement by PCR and sequencing

Transposon Mutagenesis:

  • Similar to the approach used in the original identification of RRT16, transposon mutagenesis can generate random insertional mutations

  • Use NotI-digested plasmid pools containing fragments of yeast genomic DNA with random mTn3 transposon insertions

  • Select transformants on appropriate media and verify insertion sites by sequencing

Validation Methods:

  • PCR confirmation of gene modification

  • RNA expression analysis (RT-qPCR)

  • Phenotypic analysis using the mURA3 reporter system to monitor alterations in rDNA transcription

  • Growth rate analysis under various nutrient conditions

  • Analysis of rRNA synthesis rates

  • Psoralen crosslinking to measure the proportion of active versus inactive rDNA genes

How does RRT16 respond to nutrient availability and stress conditions?

The regulation of rDNA transcription in S. cerevisiae shows dramatic responses to nutrient availability and stress conditions. Ribosomal RNA synthesis rates are very high in actively growing cells but become greatly diminished as nutrients are depleted and cells enter stationary phase . RRT16, as a regulator of rDNA transcription, likely plays a role in this nutrient-responsive regulatory network.

Several signaling pathways are implicated in the regulation of rDNA transcription in yeast, including protein kinase C-dependent regulatory circuits that respond to defects in the secretory pathway and the TOR (Target of Rapamycin) signaling pathway . RRT16 may function within one of these signaling networks, potentially serving as a downstream effector that modifies rDNA transcription in response to nutrient status.

Under stress conditions, S. cerevisiae cells induce rapid clearance of Pol I-Rrn3 complexes followed by the assembly of inactive Pol I homodimers . This dual repressive mechanism reverts upon nutrient addition. RRT16 may be involved in this transition, possibly affecting the stability of Pol I-Rrn3 complexes or promoting the formation of inactive Pol I homodimers during nutrient deprivation.

To investigate RRT16's response to nutrient availability, researchers should:

  • Monitor RRT16 expression and localization under different nutrient conditions

  • Analyze phenotypes of RRT16 mutants during nutrient shifts

  • Examine interactions between RRT16 and components of nutrient signaling pathways

  • Assess the impact of RRT16 mutations on the formation and clearance of Pol I-Rrn3 complexes

What is the potential interaction between RRT16 and chromatin-modifying complexes?

Chromatin structure plays a critical role in regulating rDNA transcription. In S. cerevisiae, the histone deacetylase Rpd3 is required for closing rDNA genes during stationary phase, although the precise mechanism remains uncertain . Additionally, the NAD⁺-dependent histone deacetylase Sir2 is involved in silencing Pol II transcription at the rDNA locus, a process known as rDNA silencing .

RRT16 may interact with these or other chromatin-modifying complexes to regulate rDNA transcription through alterations in chromatin structure. Specific research approaches to investigate this include:

  • Genetic Interaction Studies: Create double mutants of RRT16 with genes encoding chromatin modifiers (e.g., RPD3, SIR2) and analyze phenotypes to identify genetic interactions.

  • Co-immunoprecipitation (Co-IP): Detect physical interactions between RRT16 and chromatin-modifying proteins.

  • Chromatin Immunoprecipitation (ChIP): Examine changes in histone modifications at the rDNA locus in RRT16 mutants.

  • Psoralen Crosslinking: Analyze the impact of RRT16 mutations on chromatin states of rDNA genes, particularly in response to nutrient deprivation when chromatin structure at the rDNA locus typically changes.

The lysine 16 of histone H4 (H4K16) is an important target of Sir2 deacetylase activity . Researchers should investigate whether RRT16 affects this modification or other histone marks associated with transcriptionally active or repressed rDNA.

How does RRT16 contribute to rDNA stability and prevent recombination events?

The rDNA locus in S. cerevisiae is highly recombinogenic due to its repetitive nature, consisting of 150-200 head-to-tail repeats of the 9.1-kb rDNA gene . Maintaining stability of this locus is crucial for cellular function. Based on studies of other factors involved in rDNA regulation, RRT16 may contribute to rDNA stability through several potential mechanisms:

To investigate RRT16's role in rDNA stability, researchers should:

  • Measure recombination rates at the rDNA locus in RRT16 wild-type, mutant, and overexpression strains

  • Analyze genetic interactions between RRT16 and genes involved in DNA repair and recombination

  • Examine the impact of RRT16 mutations on the association of recombination and repair factors with the rDNA locus

  • Assess extrachromosomal rDNA circle (ERC) formation in RRT16 mutants, as ERCs are products of rDNA recombination events

What computational approaches can be used to identify potential RRT16 homologs across species?

To identify potential RRT16 homologs across species, researchers should employ a multi-faceted computational approach:

  • Sequence-Based Methods:

    • BLAST (Basic Local Alignment Search Tool) searches against genomic and protein databases

    • Position-Specific Iterative BLAST (PSI-BLAST) for detecting remote homologs

    • Hidden Markov Model (HMM) profiles based on known RRT16 sequences

  • Structure-Based Methods:

    • Protein structure prediction using tools like AlphaFold or RoseTTAFold

    • Structural similarity searches to identify proteins with similar folds

    • Comparative analysis of binding sites and functional domains

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees to understand evolutionary relationships

    • Analysis of conservation patterns across different taxonomic groups

    • Examination of co-evolution with interacting partners

  • Functional Annotation:

    • Gene Ontology (GO) term enrichment analysis

    • Analysis of conserved protein domains and motifs

    • Exploration of genomic context (synteny) across different species

  • Protein Interaction Surface Analysis (PIPSA):

    • Similar to the approach used for other yeast proteins, PIPSA analysis can create a fingerprint for identifying RRT16 homologs from different species

    • This approach examines electrostatic potential and molecular interaction fields

When analyzing results, researchers should be cautious about functional annotation transfers, as homologs may have evolved different functions. Experimental validation of in silico predictions is essential to confirm the functional homology of identified proteins.

How should researchers interpret conflicting data about RRT16 function?

When facing conflicting data about RRT16 function, researchers should follow these methodological approaches:

  • Assess Experimental Conditions:

    • Different growth conditions can significantly affect rDNA transcription and the function of its regulators

    • Nutrient availability, growth phase, and stress conditions may lead to different observations

    • Careful documentation and standardization of experimental conditions are essential

  • Consider Strain Backgrounds:

    • Genetic background differences can influence RRT16 phenotypes

    • Secondary mutations or polymorphisms in related pathways may affect results

    • Use isogenic strains whenever possible and verify key findings in multiple backgrounds

  • Evaluate Methodological Differences:

    • Different assays for measuring rDNA transcription have distinct sensitivities and limitations

    • Direct transcription measurements (e.g., run-on assays) may yield different results than reporter-based systems

    • Integrate data from multiple methodological approaches

  • Analyze Context-Dependent Functions:

    • RRT16 may have different functions depending on cellular context

    • It could act as both an activator and repressor depending on interactions with other factors

    • Map context-specific interactions to resolve apparently conflicting data

  • Statistical Robustness:

    • Evaluate the statistical power of conflicting studies

    • Consider sample sizes, variability, and significance thresholds

    • When possible, perform meta-analyses of multiple datasets

  • Utilize Genetic Interaction Networks:

    • Place RRT16 within broader genetic interaction networks

    • Synthetic genetic array (SGA) analysis can reveal functional relationships

    • Epistasis analysis can help determine the order of action in a pathway

By systematically addressing these factors, researchers can reconcile conflicting data and develop a more comprehensive understanding of RRT16 function within the complex regulatory network controlling rDNA transcription in S. cerevisiae.

What considerations are important when analyzing ChIP-seq or RNA-seq data for RRT16 studies?

When analyzing ChIP-seq or RNA-seq data for RRT16 studies, researchers should consider the following methodological aspects:

For ChIP-seq Analysis:

  • Experimental Design Considerations:

    • Include appropriate controls: Input DNA, IgG control, and untagged strains

    • Use spike-in normalization with chromatin from a different species for quantitative comparisons

    • Consider cell cycle synchronization, as rDNA transcription varies throughout the cell cycle

  • Peak Calling and Analysis:

    • The repetitive nature of rDNA requires specialized approaches for mapping reads

    • Use tools designed for repetitive regions, such as RepEnrich or custom mapping strategies

    • Consider the unique structure of the rDNA locus when interpreting binding patterns

  • Data Normalization:

    • Normalize for sequencing depth and local biases

    • Compare enrichment relative to input DNA rather than absolute values

    • When comparing conditions, use spike-in normalization or other methods that account for global changes

For RNA-seq Analysis:

  • rRNA Depletion Strategies:

    • Standard polyA selection won't capture rRNA precursors

    • Use rRNA depletion methods compatible with precursor rRNAs

    • Consider specialized approaches for capturing nascent transcripts

  • Read Mapping:

    • Map to a custom reference that accurately represents the rDNA repeats

    • Account for the high abundance of rRNA transcripts, which can dominate sequencing data

    • Consider using unique molecular identifiers (UMIs) to address PCR duplication issues

  • Differential Expression Analysis:

    • Use models appropriate for highly abundant transcripts

    • Consider size factors that account for the large dynamic range between rRNA and other transcripts

    • Validate findings with orthogonal methods such as RT-qPCR or Northern blotting

General Considerations:

  • Integration with Other Data Types:

    • Combine ChIP-seq and RNA-seq data to correlate binding with expression changes

    • Integrate with proteomics data to identify RRT16 interaction partners

    • Include chromatin accessibility data (ATAC-seq, DNase-seq) to understand chromatin state changes

  • Biological Replicates:

    • Include at least three biological replicates for robust statistical analysis

    • Assess reproducibility between replicates before merging data

    • Consider technical variability in library preparation and sequencing

  • Functional Validation:

    • Confirm key findings with targeted experiments

    • Use genetic approaches to validate the functional significance of binding sites

    • Consider reporter assays to directly test the impact on transcription

By carefully addressing these considerations, researchers can generate reliable and interpretable genomic data to understand RRT16's role in regulating rDNA transcription in S. cerevisiae.

What are the current knowledge gaps regarding RRT16 function and regulation?

Despite advancements in understanding rDNA transcription regulation, several significant knowledge gaps persist regarding RRT16:

  • Molecular Mechanism: The precise molecular mechanism by which RRT16 influences rDNA transcription remains unclear. Whether it acts directly on the transcription machinery or indirectly through chromatin modification needs further investigation.

  • Protein Structure: The three-dimensional structure of RRT16 has not been determined, limiting our understanding of its functional domains and interaction surfaces.

  • Regulatory Network: The position of RRT16 within the broader regulatory network controlling rDNA transcription in response to environmental signals is not fully mapped.

  • Post-translational Modifications: The regulation of RRT16 itself, including potential post-translational modifications that might modulate its activity, remains largely unexplored.

  • Evolutionary Conservation: While regulators of rDNA transcription exist across eukaryotes, the evolutionary conservation of RRT16's function has not been comprehensively studied.

  • Disease Relevance: The potential implications of RRT16 homologs in human disease, particularly in cancers where ribosome biogenesis is dysregulated, represent an important area for future research.

Addressing these knowledge gaps will require integrated approaches combining structural biology, genomics, biochemistry, and systems biology to fully elucidate RRT16's function in the complex process of rDNA transcription regulation.

How does research on RRT16 contribute to our broader understanding of eukaryotic gene regulation?

Research on RRT16 contributes significantly to our understanding of eukaryotic gene regulation in several key areas:

  • Specialized Transcriptional Regulation: Studies of RRT16 expand our knowledge of the unique regulatory mechanisms governing RNA Polymerase I transcription, which differs substantially from the better-characterized Pol II systems.

  • Coordination of Growth and Transcription: Understanding RRT16's role helps elucidate how cells coordinate ribosome biogenesis with nutrient availability and growth signals, a fundamental aspect of cellular homeostasis.

  • Chromatin-Based Regulation: Research on RRT16 provides insights into how chromatin structure influences gene expression in highly repetitive regions of the genome.

  • Genome Stability Mechanisms: Investigation of RRT16's potential role in maintaining rDNA stability contributes to our understanding of how cells prevent deleterious recombination in repetitive DNA regions.

  • Evolution of Regulatory Networks: Comparative studies of RRT16 across species can reveal evolutionary conservation and divergence in fundamental cellular processes like ribosome biogenesis.

  • Integration of Signaling Pathways: Research on RRT16 helps map how various cellular signaling pathways converge to regulate essential processes like rRNA synthesis in response to environmental changes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.