Recombinant Saccharomyces cerevisiae Putative regulator of rDNA transcription protein 1 (RRT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
RRT1; YBL048W; YBL0519; Regulator of rDNA transcription protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
RRT1
Target Protein Sequence
MILFKNLVFLPSILIGYISIRVSLLVWVNWVLVWSSCFQVAFIFSLWYFILSIYTFFYSK KIKQIISYEPSYFVFSYRAIDLCPERVLLYFFCIFNNVVFPML
Uniprot No.

Target Background

Function
Identified in a screen for mutants with decreased levels of rDNA transcription.
Database Links

STRING: 4932.YBL048W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the primary molecular function of Rtr1 in Saccharomyces cerevisiae?

Rtr1 functions as a phosphatase that specifically dephosphorylates Serine 5 in the heptad repeat of the C-terminal domain (CTD) of RNA polymerase II. This dephosphorylation is crucial during the transition from transcription initiation to elongation phases. The evidence supporting this function includes: (i) in vitro phosphatase activity against CTD peptide repeats phosphorylated by transcription kinase TFIIH, (ii) increased abundance of Ser5-phosphorylated CTD upon Rtr1 deletion in yeast, and (iii) ChIP analysis demonstrating association of RNAPII and Rtr1 during the transition from initiation to elongation .

How does Rtr1 structurally differ from other known phosphatases?

Rtr1 presents a distinct structural fold compared to other established phosphatase families. Its crystal structure at 2.6 Å resolution reveals a phosphoryl transfer domain with a deep groove formed between a zinc finger core and an α-helical pair. This groove contains a trapped sulfate ion (mimicking a phosphate group), indicating the location of the active site. The unique structural arrangement and catalytic mechanism suggest that Rtr1 belongs to a novel phosphatase family, distinct from other phosphatases in both fold and reaction mechanism .

What relationship exists between Rtr1 and rDNA transcription regulation?

While Rtr1 is primarily characterized for its role in RNA polymerase II regulation, its potential influence on rDNA transcription merits investigation. The rDNA locus in S. cerevisiae is a complex region where all three RNA polymerases (I, II, and III) are recruited, with the 2.5 kb intergenic spacer serving as a regulatory hub. RNA Pol I predominantly transcribes ribosomal genes, but the coordination between different polymerases at this locus requires sophisticated regulatory mechanisms. Rtr1's ability to modulate RNA polymerase II activity may indirectly influence the transcriptional landscape at the rDNA locus, though direct evidence for this connection requires further research .

What are effective purification strategies for obtaining functional recombinant Rtr1?

For structural and biochemical studies of Rtr1, researchers should consider:

  • Expression system optimization: Bacterial expression systems have successfully produced S. cerevisiae Rtr1 suitable for crystallography

  • Domain boundary determination: Identifying the boundaries of the phosphoryl transfer domain was crucial for successful crystallization at 2.6 Å resolution

  • Affinity purification: Histidine-tagged constructs followed by metal affinity chromatography and size exclusion chromatography

  • Buffer optimization: Including reducing agents to maintain cysteine residues in the zinc finger domain, and potentially zinc supplementation to ensure structural integrity

Which assays are most reliable for measuring Rtr1 phosphatase activity?

Two complementary approaches have proven effective for assessing Rtr1 phosphatase activity:

  • Physiological substrate assay: Using CTD peptide repeats phosphorylated by transcription kinase TFIIH, with activity measured by detecting dephosphorylation through phospho-specific antibodies or mass spectrometry

  • Chemical substrate assay: Using 6,8-difluoro-4-methylumbelliferyl phosphate (DiFMUP), which produces a fluorescent signal upon dephosphorylation

These assays can be employed to characterize wild-type and mutant forms of Rtr1, enabling structure-function analyses. Activity comparisons between orthologous proteins (e.g., S. cerevisiae Rtr1 vs. K. lactis Rtr1) have revealed species-specific differences in activity profiles .

How can researchers effectively design mutagenesis experiments to probe Rtr1 function?

Based on structural data, targeted mutagenesis of residues lining the putative active site groove has proven effective in dissecting Rtr1 function. Key considerations include:

  • Structure-guided selection of residues in the deep groove between the zinc finger domain and α-helical pair

  • Conservative and non-conservative substitutions to distinguish between structural and catalytic roles

  • Parallel assessment through:

    • In vitro phosphatase assays with DiFMUP or phosphorylated CTD substrates

    • Yeast complementation assays to determine if mutants rescue growth of Rtr1-deleted strains

    • ChIP analysis to assess recruitment to transcription sites

    • Western blotting with phospho-specific antibodies to monitor CTD phosphorylation states in vivo

How does the catalytic mechanism of Rtr1 differ from classical phosphatase families?

Rtr1 employs a unique catalytic mechanism distinct from established phosphatase families:

  • Active site architecture: Features a deep groove between the zinc finger domain and α-helical pair, rather than the classical phosphatase active site configurations

  • Metal coordination: While many phosphatases utilize metal ions (Mg2+, Mn2+) for catalysis, the precise role of the zinc in Rtr1's catalytic mechanism versus structural stabilization requires clarification

  • Residue contributions: Mutagenesis has identified critical residues lining the active site groove that are essential for catalysis but differ from conserved motifs in other phosphatase families

Further mechanistic studies employing enzyme kinetics, pH-rate profiles, and computational approaches would help elucidate the precise catalytic steps and intermediates in the Rtr1-mediated phosphoryl transfer reaction .

What explains the functional differences between Rtr1 orthologs from different yeast species?

Comparative analysis of Rtr1 from different yeast species has revealed notable functional differences:

PropertySaccharomyces cerevisiae Rtr1Kluyveromyces lactis Rtr1
Crystal Structure Resolution2.6 Å4 Å (low resolution)
Phosphatase Activity Against CTDDemonstrated in vitroNot detected under same conditions
Identifiable Active SiteDeep groove with trapped sulfateNo putative active site pocket identified
Essential ResiduesIdentified through mutagenesisNot characterized in detail

These differences may result from:

  • Subtle structural variations affecting active site geometry

  • Species-specific requirements for CTD regulation

  • Divergent evolution of regulatory mechanisms

  • Potential differences in experimental conditions or protein preparation

Systematic comparative biochemical and structural analyses could provide insights into the evolutionary conservation and specialization of Rtr1 function across fungal species .

How does Rtr1 integrate into the complex regulatory network of the rDNA locus?

The rDNA locus in S. cerevisiae represents a fascinating regulatory hub where multiple molecular processes converge:

  • Spatial organization: All three RNA polymerases operate within the confined 2.5 kb intergenic spacer region

  • Coordination challenges: Transcription, replication, and recombination machineries must be carefully coordinated to avoid conflicts

  • Regulatory factors: Proteins like Fob1, Sir2, Top1, Reb1, and Abf1 contribute to the complex regulatory network

Rtr1's role in modulating RNA polymerase II activity could potentially influence this network through:

  • Altered phosphorylation states of RNA polymerase II at rDNA-adjacent regions

  • Indirect effects on non-coding RNA transcription within the rDNA locus

  • Potential interactions with other regulatory factors operating in this region

Techniques such as ChIP-seq, genetic interaction screens, and proteomic approaches could help elucidate Rtr1's potential contributions to rDNA regulation .

How should researchers address contradictory findings regarding Rtr1's phosphatase activity?

The phosphatase activity of Rtr1 has been subject to some controversy, with different studies reporting varying results. To address these contradictions:

  • Methodological considerations:

    • Ensure protein preparation maintains structural integrity and activity

    • Use multiple complementary assay systems (both physiological and chemical substrates)

    • Control for buffer conditions, metal ion concentrations, and reaction parameters

  • Comparative approaches:

    • Direct side-by-side comparison of orthologs from different species

    • Include appropriate positive and negative controls

    • Standardize protein concentrations and substrate availability

  • Validation strategies:

    • Correlate in vitro activity with in vivo phenotypes

    • Employ structure-guided mutagenesis to test mechanistic hypotheses

    • Consider potential cofactors or interacting proteins that might influence activity

By systematically addressing these factors, researchers can develop a more nuanced understanding of the conditions under which Rtr1 exhibits phosphatase activity .

What controls are essential when analyzing Rtr1's impact on transcription regulation?

When investigating Rtr1's effects on transcription and RNA polymerase II regulation, several critical controls should be implemented:

  • Genetic controls:

    • Wild-type vs. Rtr1 deletion strains

    • Complementation with wild-type Rtr1

    • Complementation with catalytically inactive Rtr1 mutants

  • Phosphorylation analysis:

    • Monitor multiple CTD phosphorylation sites (Ser2, Ser5, Ser7, Tyr1, Thr4)

    • Use phospho-specific antibodies with validated specificity

    • Consider using mass spectrometry for quantitative phosphorylation profiling

  • Transcriptional context:

    • Assess effects across different gene classes (highly expressed, inducible, constitutive)

    • Examine different phases of transcription (initiation, elongation, termination)

    • Consider potential indirect effects through other regulatory pathways

  • Temporal dynamics:

    • Time-course experiments to capture transient effects

    • Synchronization strategies to control for cell cycle effects

    • Inducible depletion systems for acute vs. chronic Rtr1 loss

This comprehensive approach enables accurate interpretation of Rtr1's contributions to transcriptional regulation while controlling for potential confounding factors .

How might Rtr1 function be influenced by cellular stress conditions?

The regulation of transcription frequently responds to changing cellular conditions. Investigating Rtr1's role under various stress conditions could reveal conditional functions:

  • Iron deficiency responses: The ribosome profiling data on iron limitation suggests complex translational regulation involving RNA-binding proteins Cth1 and Cth2. Whether Rtr1 contributes to these adaptive responses remains unexplored .

  • Potential research approaches:

    • Comparative phosphoproteomics of CTD modifications under various stress conditions in wild-type vs. Rtr1-deficient cells

    • ChIP-seq analysis of Rtr1 occupancy under different environmental conditions

    • Genetic interaction screens to identify synthetic interactions that emerge specifically under stress conditions

    • Transcriptome analysis to identify Rtr1-dependent gene expression changes in response to different stressors

  • Methodological considerations:

    • Carefully control stress intensity and duration

    • Consider acute vs. chronic stress responses

    • Monitor Rtr1 expression, localization, and modification under stress conditions

What is the evolutionary relationship between fungal Rtr1 and mammalian RPAP2?

Comparative analysis between yeast Rtr1 and its mammalian counterpart RPAP2 could yield insights into conserved mechanisms and evolutionary innovations:

  • Functional conservation: Evidence suggests conserved phosphatase activity and reaction mechanisms between Rtr1 and RPAP2, despite potential structural differences .

  • Research approaches:

    • Comparative structural analysis of the phosphoryl transfer domains

    • Complementation experiments testing if RPAP2 can rescue Rtr1-deficient yeast

    • Domain-swapping experiments to identify functionally conserved regions

    • Phosphatase assays with standardized substrates to compare kinetic parameters

  • Evolutionary implications:

    • Mapping the distribution of Rtr1/RPAP2 homologs across eukaryotic lineages

    • Identifying conserved vs. lineage-specific interaction partners

    • Comparing integration into transcriptional regulatory networks

    • Assessing specialization of function in complex multicellular organisms

By bridging research on fungal and mammalian systems, these studies could illuminate both fundamental mechanisms of transcriptional regulation and the evolutionary diversification of these regulatory systems.

How does Rtr1 function coordinate with other CTD-modifying enzymes?

RNA polymerase II CTD undergoes dynamic phosphorylation and dephosphorylation throughout the transcription cycle, involving multiple enzymes:

  • CTD modification cycle components:

    • Kinases: CDK7/Kin28 (Ser5), CDK9/Bur1 (Ser2)

    • Phosphatases: Rtr1 (Ser5), Fcp1 (Ser2), Ssu72 (Ser5/Ser7)

  • Potential coordination mechanisms:

    • Sequential recruitment to transcription complexes

    • Overlapping or exclusive substrate specificities

    • Cross-regulation between different modifying enzymes

    • Integration with chromatin modifications and RNA processing

  • Research approaches:

    • Epistasis analysis combining mutations in multiple CTD-modifying enzymes

    • Biochemical reconstitution of CTD modification cascades

    • Single-molecule approaches to track CTD modification dynamics

    • System-level modeling of the CTD modification cycle

How does Rtr1 contribute to the coordination between transcription and rDNA metabolism?

The rDNA locus represents a fascinating system where multiple essential processes must be carefully coordinated:

  • Key processes at the rDNA locus:

    • Transcription by all three RNA polymerases

    • Replication with specific features including replication fork barriers

    • Recombination maintaining sequence homogeneity between repeats

    • Chromatin-based regulation involving Sir2-dependent silencing

  • Potential Rtr1 contributions:

    • Regulation of RNA polymerase II activity in regions adjacent to or within rDNA

    • Influence on non-coding RNA expression that might affect rDNA chromatin states

    • Potential indirect effects on RNA polymerase I regulation

    • Coordination with replication to prevent transcription-replication conflicts

  • Research approaches:

    • ChIP-seq analysis of Rtr1 localization relative to rDNA elements

    • Analysis of rDNA stability, copy number, and recombination rates in Rtr1-deficient cells

    • Genetic interaction screens with known rDNA regulators (Fob1, Sir2, Top1)

    • Investigation of potential protein-protein interactions between Rtr1 and rDNA-associated factors

This integrated approach would help uncover how Rtr1's phosphatase activity contributes to the complex regulatory network at the rDNA locus.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.