Recombinant Saccharomyces cerevisiae Putative succinate dehydrogenase [ubiquinone] cytochrome b small subunit YLR164W, mitochondrial (YLR164W)

Shipped with Ice Packs
In Stock

Description

Introduction

The yeast Saccharomyces cerevisiae is a widely used model organism in biological research, particularly for studying mitochondrial function and protein quality control . Within the mitochondrial proteome of S. cerevisiae, many proteins still lack functional characterization . One such protein is YLR164W, a putative succinate dehydrogenase [ubiquinone] cytochrome b small subunit, also known as Shh4 . Succinate dehydrogenase (SDH) is a key enzyme in the citric acid cycle and the electron transport chain, playing a vital role in cellular energy production. YLR164W/Shh4 is involved in mitochondrial function, as has been demonstrated in studies of yeast growth in mucin .

Protein Function and Characterization

YLR164W is a mitochondrial protein in Saccharomyces cerevisiae. Hao et al. (2009), Heo et al. (2010), Bricker et al. (2012), and Chen et al. (2012) have worked to functionally annotate the mitochondrial proteome, including YLR164W. YLR164W, also known as Shh4, has been identified as a protein with a potential role in mitochondrial function and is offered by Creative BioMart for life science research .

Role in Mitochondrial Protein Quality Control

Mitochondrial protein quality control is essential for maintaining proper cellular function . Msp1/ATAD1 is a protein involved in this process, preventing the accumulation of mislocalized TA proteins in the mitochondria. Depletion of Msp1 leads to a loss of mtDNA and mitochondrial resident proteins, as well as altered mitochondrial morphology .

Impact of Mitochondrial Introns on Function

The presence of self-splicing mitochondrial introns can significantly impact mitochondrial function in S. cerevisiae . Studies have shown that removing these introns can lead to a stress phenotype, affecting mitochondrial morphology, volume, oxygen consumption, ATP levels, and chronological lifespan. Normal mitochondrial function in S. cerevisiae requires inefficient splicing, demonstrating the importance of these introns in mitochondrial gene expression .

Mtm1p and Mitochondrial Iron Homeostasis

YGR257Cp (Mtm1p) is another mitochondrial carrier protein in Saccharomyces cerevisiae that plays a crucial role in mitochondrial iron homeostasis and respiratory functions . Although its carrier substrate was previously unknown, research has shown that Mtm1p binds pyridoxal 5'-phosphate (PLP), suggesting it functions as a high-affinity PLP transporter in mitochondria .

Interaction with Other Proteins

Research indicates that YLR164W/Shh4 interacts with other proteins involved in mitochondrial function. For example, Sdh3 has a dual function in the respiratory chain and the TIM22 protein translocase of the mitochondrial inner membrane . Additionally, PYURF, an uncharacterized protein, may bridge essential and interrelated pathways within the mitochondria, potentially interacting with CI-related proteins .

MTCH2 and Mitochondrial Membrane Insertion

MTCH2 is responsible for inserting alpha-helical proteins into the mitochondrial outer membrane in their correct orientation. The outer membrane of the mitochondria facilitates multiple processes, such as helping the cell recognize pathogens, initiating a self-destruct process called apoptosis, and the breakdown of brain signaling molecules such as dopamine .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
SHH4; YLR164W; Mitochondrial inner membrane protein SHH4; SDH4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-168
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
SHH4
Target Protein Sequence
FTIPFLPKIPQKPGGVSGTANDSSYMPPESRAQGSYHWIVERGLSLAVLPLIAVPLVTTG PISTFTDTFLSLVLLGHCHIGFQSCIIDYISERVYGKVHHYAMYLLSLGSFLSFVGIYKL ESQEAGLIASLKSLWDNKPVEKKRQ
Uniprot No.

Target Background

Function

Homolog of SDH4; however, it does not appear to be a stoichiometric subunit of either the succinate dehydrogenase (SDH) complex or the mitochondrial inner membrane translocase TIM22 complex.

Database Links

KEGG: sce:YLR164W

STRING: 4932.YLR164W

Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is YLR164W and what is its genomic location in Saccharomyces cerevisiae?

    YLR164W is a putative succinate dehydrogenase [ubiquinone] cytochrome b small subunit located on chromosome XII in S. cerevisiae, specifically in the right ribosomal DNA flank region . The predicted protein sequence of YLR164W shows 52% similarity to Sdh4p, a known component of the succinate dehydrogenase complex . Notably, YLR164W contains a histidine residue in a position homologous to SdhD His71 in E. coli SdhD, suggesting potential functional conservation .

    This gene has been studied in the context of DNA double-strand break (DSB) formation and appears to be a site where Pch2-dependent regulation of Spo11-mediated DSB formation occurs during meiosis .

  • What experimental approaches are available for manipulating YLR164W in yeast?

    Several molecular techniques can be employed to manipulate YLR164W in S. cerevisiae:

    TechniqueDescriptionAdvantagesReference
    Transformation-associated recombination cloningUtilizes yeast's homologous recombination machinery to assemble DNA fragmentsEfficient for large constructs
    CRISPR/Cas9 genome editingPrecise genome editing using guide RNAs targeting YLR164W locusHigh specificity and efficiency
    Epitope taggingAddition of tags (FLAG, TAP, GFP, etc.) to track protein expression and localizationEnables visualization and purification
    Gene knockoutComplete deletion of YLR164W using selectable markersAssess loss of function phenotypes

    When designing genetic manipulations, consider using a high-expression locus for integration if overexpression is desired, or maintain the native locus for studying physiological expression patterns .

  • How can I confirm successful genetic modification of YLR164W?

    Multiple validation methods should be employed:

    • PCR confirmation using primers flanking the integration site

    • Growth on selective media containing appropriate antibiotics (G418, NAT, HYG) or nutrient deprivation media

    • Western blot analysis using antibodies against epitope tags (if tagged versions were created)

    • Southern blot analysis to verify genomic integration and copy number

    • Functional complementation assays in YLR164W deletion strains to confirm activity

    For example, when verifying epitope-tagged versions, immunoprecipitation followed by western blot analysis can confirm expression, as demonstrated for other yeast proteins: "Co-immunoprecipitation of 3xFlag-Pch2 and 3xFlag-Pch2 243-564 with Orc1–TAP (via α-TAP-IP) during the meiotic prophase (4 h into meiotic program). For α-Flag, short and long exposures are shown. α-Pgk1 is used as a loading control."

  • What growth conditions are optimal for studying YLR164W expression and function?

    Based on experimental protocols in the literature, consider the following conditions:

    • Standard yeast-peptone (YP) medium containing 10 g/L yeast extract, 20 g/L bacteriological peptone, and 0.33 g/L L-tryptophan

    • Carbon sources: 2% dextrose (YPD) for standard growth conditions

    • For specialized metabolic studies: 0.5% Type III porcine gastric mucin (YPM)

    • Temperature: Standard cultivation at 30°C, but consider temperature sensitivity experiments at 23°C

    • For meiotic studies, use established meiosis-inducing protocols and collect samples at various time points (e.g., 4h into meiotic program)

Advanced Research Questions

  • How can I design experiments to study the role of YLR164W in DNA double-strand break (DSB) formation?

    Design a comprehensive experimental approach based on published methodologies:

    1. Create the following strains:

      • Wild-type control

      • YLR164W deletion (ylr164wΔ)

      • DSB repair-deficient background (e.g., dmc1Δ) to allow DSB accumulation

      • Combined mutants (e.g., ylr164wΔ dmc1Δ)

    2. Synchronize meiotic progression using established protocols

    3. Collect time-course samples after meiotic induction (0h, 2h, 4h, 6h, 8h)

    4. Perform Southern blot analysis of the YLR164W locus and a control DSB region (e.g., YCR047C on chromosome III)

    Expected results table:

    StrainYLR164W locus DSBsControl locus DSBsInterpretation
    Wild-typeModerate levelsModerate levelsNormal DSB formation
    dmc1ΔAccumulationAccumulationDSBs form but cannot be repaired
    ylr164wΔ dmc1ΔAltered patternNormal accumulationYLR164W affects local DSB formation
    Complemented strainRescue of wild-type patternNormal patternConfirms YLR164W function

    Remember that "Southern blot analysis of YLR164W locus (right ribosomal DNA flank; chromosome XII) and YCR047C locus (control DSB region; chromosome III), in dmc1Δ, pch2Δ dmc1Δ backgrounds" has been successfully used to detect meiotic DSBs .

  • What methods can I use to investigate YLR164W protein interactions and function in the succinate dehydrogenase complex?

    Multiple complementary approaches should be employed:

    MethodProtocol OutlineApplicationsReference
    Yeast two-hybridTest direct interaction between YLR164W and other SDH componentsInitial screening for interactions
    Co-immunoprecipitationEpitope-tag YLR164W (e.g., 3xFlag-YLR164W) and potential interactors (e.g., TAP-tagged proteins); perform IP followed by western blotValidate interactions in vivo
    Pulldown assaysExpress and purify recombinant proteins (e.g., His-MBP-YLR164W) from heterologous systems like insect cells; perform amylose-based pulldownBiochemical verification of direct interactions
    Size exclusion chromatographyAnalyze complex formation using purified componentsDetermine stoichiometry and complex stability
    Cross-linking mass spectrometryIdentify specific residues involved in protein-protein interactionsDetailed molecular interaction mapping

    For pulldown assays, protocols similar to those described for Pch2 can be adapted: "Amylose-based pulldown of His–ORC (His–Orc1-6) purified from insect cells, with His–MBP–Pch2 or His–MBP–Pch2-243-564. Coomassie Brilliant Blue (CBB) staining."

  • How can I investigate the potential role of YLR164W in homologous recombination (HR) and genomic stability?

    Recent studies have highlighted HR as an important genetic process that can lead to loss of production capacity in engineered S. cerevisiae strains . To investigate YLR164W's potential role:

    1. Create reporter systems:

      • Integrate fluorescent reporter constructs that activate upon HR events

      • Design systems with direct repeats flanking the YLR164W gene

    2. Engineer strains with variable expression levels:

      • YLR164W deletion

      • YLR164W overexpression

      • YLR164W-fluorescent protein fusions to track expression levels

    3. Measure HR rates in populations:

      • Flow cytometry sorting based on fluorescent reporter activation

      • Compare HR rates in YLR164W high-expressing vs. low-expressing cells

    4. Long-term stability analysis:

      • Conduct extended cultivation experiments (>90 generations)

      • Regularly assess copy number variation and genetic stability

    This approach is based on methods described for studying HR heterogeneity: "The enrichment in Rad52-high cells did not lead to visible phenotypic effects in terms of sugar consumption. Of note, the final OD for Rad52-high populations progressively decreased compared to the Rad52-low and the non-sorted populations, which could be due to high expression of the YFP-tdTomato, high Rad52 expression levels or indirect consequences."

  • What metabolic engineering approaches can be used to study YLR164W in relation to succinate dehydrogenase function?

    As a putative succinate dehydrogenase component, YLR164W may play roles in cellular metabolism. Several approaches can be employed:

    1. Knockout strain characterization:

      • Create YLR164W deletion strains

      • Compare growth rates on different carbon sources

      • Measure oxygen consumption rates and respiratory capacity

    2. Multi-gene manipulations:

      • Create strains with combinations of modifications to SDH components

      • Design double knockouts (e.g., YLR164W with other SDH components)

      • Employ codon-optimized synthetic genes for heterologous expression

    3. Metabolomic analysis:

      • Perform targeted metabolomics focusing on TCA cycle intermediates

      • Use GC/MS, LC/MS or NMR to quantify metabolite levels

      • Compare metabolic profiles between wild-type and engineered strains

    4. Carbon flux analysis:

      • Use 13C-labeled glucose to trace carbon flow through central metabolism

      • Quantify flux differences between wild-type and YLR164W-modified strains

    Similar approaches have been successfully applied to study recombinant enzyme production: "GC/MS analysis of culture filtrates of this strain showed 11 times higher response in EIC for the m/z 479 (methyloxime-tetra-TMS derivative of 2-DOI) than the YP-btrC recombinant that has only a single copy of btrC expression cassette integrated into the genomic DNA of the CEN.PK strain."

  • How should I design experiments to understand YLR164W's evolutionary significance across yeast species?

    To investigate evolutionary aspects of YLR164W:

    1. Comparative sequence analysis:

      • Identify homologs across yeast species using BLAST searches

      • Perform multiple sequence alignments to identify conserved residues

      • Generate phylogenetic trees to visualize evolutionary relationships

    2. Structure-function predictions:

      • Use tools like PSIPRED for secondary structure predictions

      • Generate 3D structural models based on homology to known structures

      • Identify conserved functional domains and motifs

    3. Cross-species functional complementation:

      • Express YLR164W homologs from different species in S. cerevisiae ylr164wΔ strains

      • Test functional rescue of phenotypes

      • Create chimeric proteins with domains from different species

    4. Comparative biochemical analysis:

      • Express and purify homologous proteins from different species

      • Compare biochemical properties and interaction partners

      • Analyze functional differences and similarities

    This approach is supported by successful sequence analysis methods: "Sequence alignments of Pch2 from indicated species, including PSIPRED secondary structure predictions. Boxes indicate key AAA+ features, * indicates generated truncation boundaries. Sequence alignments were generated using MAFFT/L-INS-i. Secondary structure predictions were made using PSIPRED. Alignments were visualized using Jalview."

  • What transcriptomic approaches are most effective for studying YLR164W expression regulation?

    To investigate the regulation of YLR164W expression:

    1. Global expression analysis:

      • Perform RNA-Seq or microarray analysis under different conditions

      • Compare YLR164W expression patterns with other genes in related pathways

      • Identify co-regulated gene clusters

    2. Promoter analysis:

      • Identify transcription factor binding sites in the YLR164W promoter

      • Perform ChIP-qPCR to confirm binding of transcription factors

      • Create reporter constructs with wild-type and mutated promoter elements

    3. 3' UTR analysis:

      • Search for conserved octa-nucleotide sequences in the 3' untranslated region (250 nt)

      • Use regulatory sequence analysis tools to identify potential motifs

      • Calculate E-values to assess motif significance

    4. Epigenetic regulation:

      • Investigate chromatin state at the YLR164W locus

      • Analyze histone modifications associated with active/inactive transcription

      • Assess the impact of chromatin modifiers on YLR164W expression

    This approach is supported by established methods: "A search for conserved octa-nucleotide sequences in the 3′ untranslated region (250 nt) was performed using regulatory sequence analysis tools. The occurrence of the discovered motif in the group of genes tested (163 genes) was compared with the expected occurrence of a group of same size randomly picked. The E-value represents the probability of finding the number of patterns with the same level of overrepresentation."

  • What statistical approaches are most appropriate for analyzing experimental data related to YLR164W function?

    Selecting appropriate statistical methods is crucial for robust data analysis:

    MethodApplicationMinimum Sample SizeReference
    RIAA (Real Value Iterative Adaptive Approach)Time-series data analysis, spectral estimation9 (p<0.05), 14 (p<0.005)
    Lomb-Scargle PeriodogramNon-uniformly sampled time-series data12 (p<0.05), 19 (p<0.005)
    LSPR (Lomb-Scargle Periodogram Regression)Combined approach for periodicity detection12 (p<0.05), 19 (p<0.005)
    Robust Capon MethodHandling corrupted biological data22 (p<0.05), 26 (p<0.005)
    MAPES MethodMissing data compensation in time-series20 (p<0.05), 26 (p<0.005)
    Hypergeometric distribution testFunctional category enrichmentDependent on dataset size

    For expression analysis, proper normalization is essential: "Applying the same formula, the probability was calculated where N is the total number of genes where the TF can bind upstream, M is the total number of genes in the cluster, and G is the total number of gene features on the YG98S array (6383)."

  • How can I design a comprehensive experimental approach to characterize YLR164W's role in mitochondrial function?

    As a putative mitochondrial protein, YLR164W may play important roles in mitochondrial processes:

    1. Subcellular localization studies:

      • Create YLR164W-GFP fusions to visualize localization

      • Perform mitochondrial fractionation followed by western blot analysis

      • Use MitoTracker dyes for co-localization experiments

    2. Respiratory function analysis:

      • Compare oxygen consumption rates between wild-type and YLR164W mutant strains

      • Measure growth on fermentable (glucose) vs. non-fermentable (glycerol, ethanol) carbon sources

      • Analyze sensitivity to respiratory inhibitors

    3. Mitochondrial membrane potential:

      • Use potential-sensitive dyes (e.g., TMRM, JC-1) to assess membrane potential

      • Compare potential differences between wild-type and mutant strains

      • Test effects of oxidative stress on membrane potential

    4. Interaction with other mitochondrial proteins:

      • Perform proteomics on purified mitochondria from WT and YLR164W mutants

      • Identify altered protein complexes or abundances

      • Validate changes through co-immunoprecipitation and western blotting

    5. Experimental design considerations:

      • Use between-subjects design comparing different strains

      • Control extraneous variables such as growth phase and media composition

      • Include appropriate controls (wild-type, known mitochondrial mutants)

      • Plan for replicate experiments to ensure statistical validity

    This comprehensive approach will provide insights into YLR164W's role in mitochondrial function while adhering to proper experimental design principles described in the scientific literature .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.