Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YAR047C (YAR047C)

What is YAR047C protein and where is it found?

YAR047C is a putative uncharacterized membrane protein found in Saccharomyces cerevisiae (baker's yeast). The protein consists of 106 amino acids with the sequence: MYQTSPLSLFYFQVLVPKFLECFLCFPYHKISLVALLSFFYCQLQTNMIILLSQIKRFLYRQIMIALKIKAKKFWFIFKYFNVSCDARLFNELFYIFQTYVSVDSK . This protein has been assigned the UniProt ID P39557 and is classified as a membrane protein based on its hydrophobicity profile and predicted transmembrane domains. YAR047C is encoded by a gene located on chromosome I of S. cerevisiae and is expressed at relatively low levels under standard growth conditions.

What are the structural characteristics of recombinant YAR047C?

Recombinant YAR047C can be produced as a full-length protein (1-106 amino acids) with fusion tags to facilitate purification and detection. Commonly, it is expressed with an N-terminal His tag, which enables efficient purification using metal affinity chromatography . The protein has multiple hydrophobic regions consistent with its classification as a membrane protein. Based on sequence analysis, YAR047C contains:

How is recombinant YAR047C typically produced?

The recombinant form of YAR047C is typically produced in E. coli expression systems, which provide a cost-effective and scalable approach to protein production . The production process involves:

• Cloning the YAR047C gene into an appropriate expression vector with a His-tag coding sequence

• Transforming the construct into a suitable E. coli strain (commonly BL21(DE3) or similar)

• Inducing protein expression under optimized conditions

• Cell lysis to release the protein

• Purification via metal affinity chromatography using the His-tag

• Additional purification steps as needed (e.g., size exclusion chromatography)

• Quality control assessment including SDS-PAGE for purity evaluation

• Appropriate storage of the purified protein (typically >90% purity)

What are the optimal storage conditions for recombinant YAR047C?

Based on available data, the optimal storage conditions for recombinant YAR047C are:

• Store the lyophilized powder at -20°C/-80°C upon receipt

• For reconstituted protein, aliquoting is necessary to avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

• Long-term storage should be at -20°C/-80°C with 5-50% glycerol (50% is the default recommendation)

• The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose, pH 8.0

Repeated freeze-thaw cycles should be avoided as they can lead to protein degradation and loss of activity .

What expression systems are most effective for YAR047C production?

While E. coli is the most commonly used expression system for YAR047C , researchers should consider multiple expression systems based on experimental requirements:

For most basic research applications, E. coli expression using BL21(DE3) strain with a pET vector system provides sufficient quantity and quality of recombinant YAR047C .

How can I verify the purity and activity of recombinant YAR047C?

Verification of purity and activity should follow a systematic approach:

What are recommended reconstitution procedures for lyophilized YAR047C?

Proper reconstitution is critical for maintaining protein activity:

• Briefly centrifuge the vial containing lyophilized protein prior to opening to bring contents to the bottom

• Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

• Add glycerol to a final concentration of 5-50% (50% is recommended) for long-term storage

• Aliquot into smaller volumes to prevent repeated freeze-thaw cycles

• For membrane protein studies, consider reconstitution into lipid nanodisc or detergent micelles for stability

How can YAR047C be used in membrane protein research models?

YAR047C represents an interesting subject for membrane protein research due to its uncharacterized nature. Advanced applications include:

• Structural Biology Approaches:

  • X-ray crystallography (challenging for membrane proteins)

  • Cryo-electron microscopy for structure determination

  • NMR spectroscopy for dynamic studies

  • Molecular dynamics simulations to predict membrane interactions

• Functional Characterization:

  • Yeast two-hybrid screening to identify interaction partners

  • Co-immunoprecipitation studies to validate protein interactions

  • Localization studies using fluorescently tagged variants

  • Deletion/mutation analysis to assess phenotypic effects

• Comparative Analysis:

  • Study of homologous proteins across fungal species

  • Evolutionary conservation analysis to predict functional importance

  • Systems biology approaches to place YAR047C in cellular networks

What techniques are best for studying the localization of YAR047C in vivo?

For studying YAR047C localization in living cells, several complementary approaches are recommended:

A combination of these approaches provides the most reliable localization data, with particular attention to controlling for tag-induced artifacts through functional validation.

Why might recombinant YAR047C show reduced activity or aggregation in my assays?

Membrane proteins like YAR047C are particularly challenging to work with. Common issues and solutions include:

• Protein Aggregation:

  • Cause: Improper folding, detergent mismatch, concentration too high

  • Solution: Screen different detergents, reduce protein concentration, add stabilizers like glycerol or specific lipids

• Low Expression Yield:

  • Cause: Toxicity to host, formation of inclusion bodies, codon bias

  • Solution: Use controlled expression systems, lower induction temperature, optimize codon usage for expression host

• Degradation:

  • Cause: Protease contamination, improper storage, repeated freeze-thaw

  • Solution: Add protease inhibitors during purification, store with glycerol, avoid freeze-thaw cycles

• Poor Solubility:

  • Cause: Hydrophobic nature of membrane proteins

  • Solution: Test different solubilization buffers, use mild detergents, consider membrane mimetics like nanodiscs

• Loss of Activity:

  • Cause: Denaturation, loss of essential cofactors, oxidation of critical residues

  • Solution: Include reducing agents, add potential cofactors, optimize buffer conditions

How should results from YAR047C studies be validated?

Validation of research findings for uncharacterized proteins like YAR047C requires multiple layers of confirmation:

• Technical Validation:

  • Independent experimental replicates (minimum of three)

  • Use of appropriate positive and negative controls

  • Application of different methodological approaches to confirm findings

• Biological Validation:

  • Complementary assays that approach the question from different angles

  • In vivo confirmation of in vitro findings

  • Genetic approaches (knockout/knockdown followed by complementation)

  • Use of structurally similar proteins as comparisons

• Computational Validation:

  • Structure prediction tools to support experimental findings

  • Sequence analysis to identify conserved domains

  • Network analysis to place findings in biological context

What are emerging technologies for studying membrane proteins like YAR047C?

The field of membrane protein research is rapidly evolving with several promising technologies:

• Cryo-EM Advances:

  • Single-particle cryo-EM for structural determination without crystallization

  • Microcrystal electron diffraction (MicroED) for structural studies using smaller crystals

• Native Mass Spectrometry:

  • Analyzing membrane proteins in near-native states

  • Characterizing protein-lipid interactions

• Advanced Microscopy:

  • Super-resolution microscopy for visualizing protein arrangements in membranes

  • Correlative light and electron microscopy (CLEM) for multiscale imaging

• Computational Approaches:

  • Improved membrane protein structure prediction algorithms

  • Molecular dynamics simulations with enhanced membrane modeling

• Gene Editing Tools:

  • CRISPR-Cas9 for precise genomic tagging and functional studies

  • Base editors for studying specific amino acid contributions

How might structural analysis of YAR047C advance our understanding?

Structural characterization of YAR047C would significantly enhance our understanding of this protein and potentially similar uncharacterized membrane proteins:

• Structure determination could reveal:

  • Membrane topology and orientation

  • Presence of functional domains or motifs not evident from sequence alone

  • Potential binding sites for ligands or interaction partners

  • Conformational states that might suggest function

• Comparative structural analysis could:

  • Identify structural similarities to functionally characterized proteins

  • Reveal evolutionary relationships not detected at sequence level

  • Suggest potential functions based on structural homology

• Structure-guided experiments would enable:

  • Rational design of mutations to test functional hypotheses

  • Development of specific inhibitors or modulators

  • Prediction of interaction interfaces with other proteins