Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YBL062W (YBL062W)

Shipped with Ice Packs
In Stock

Description

Production and Recombinant Forms

The recombinant YBL062W protein is produced via heterologous expression systems, with variations in host organisms and purification tags. Key production parameters include:

ParameterDetailsSources
Host OrganismsE. coli, yeast, Baculovirus, mammalian cells, or cell-free systems
Purification TagsN-terminal His-tag (common), other tags depending on host
Purity≥85% (SDS-PAGE) for most products; ≥90% for optimized E. coli variants
ApplicationsSDS-PAGE, Western blot, ELISA, structural studies

Partial vs. Full-Length: Full-length recombinant YBL062W (1–126 amino acids) is widely available, while partial variants are less common .

Functional and Mechanistic Insights

Despite extensive production, YBL062W’s biological role remains unclear. Key gaps include:

  • Pathway Involvement: No validated pathways or interacting proteins are documented, though preliminary databases suggest potential roles in membrane trafficking or stress response .

  • Expression Patterns: No expression data is available in the Saccharomyces Genome Database (SGD), indicating limited natural expression studies .

Research Applications and Experimental Uses

The recombinant protein is employed in diverse assays:

ApplicationMethodRelevanceSources
SDS-PAGEPurity validationConfirming recombinant protein integrity
ELISAAntibody cross-reactivity testingDeveloping detection tools for yeast studies
Western BlotProtein-protein interaction studiesIdentifying binding partners

Antibody Availability: A rabbit polyclonal antibody (IgG isotype) is used for immunodetection, enabling downstream applications like epitope mapping .

Current Research Challenges and Future Directions

  • Functional Elucidation: High-throughput screens (e.g., yeast two-hybrid) are needed to identify interacting partners and pathways.

  • Expression Analysis: Transcriptomic/proteomic studies in S. cerevisiae strains under stress or growth conditions could clarify its role .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement. We will accommodate your request whenever possible.

Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
YBL062W; YBL0505; Putative uncharacterized membrane protein YBL062W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-126
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YBL062W
Target Protein Sequence
MCTYIITQSFFFLPCLSFLFFKLVGFFDSVFTAGKSLRIMFELPIFDKLTSCFAAIDCSA TSLDIPFAEEELFLMLVSEPVLIPFLFVFEFMLICKPCGSRSRFGFPVKNVSDFEETLEF DPTLLV
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing recombinant YBL062W?

Multiple expression systems have been validated for the production of recombinant YBL062W, each with distinct advantages depending on your research objectives:

Expression SystemAdvantagesConsiderationsTypical Yields
E. coliCost-effective, rapid growth, high yieldsMay lack post-translational modifications found in eukaryotesHigh (>85% purity by SDS-PAGE)
Yeast (homologous)Native post-translational modifications, proper folding of membrane proteinsSlower growth than E. coli, moderate yieldsModerate-high (>85% purity by SDS-PAGE)
BaculovirusEukaryotic post-translational modifications, suitable for complex proteinsMore complex setup, longer production timeModerate-high (>85% purity by SDS-PAGE)
Mammalian CellMost authentic eukaryotic modifications, potentially better for functional studiesExpensive, technically demanding, lower yieldsModerate (>85% purity by SDS-PAGE)
Cell-Free ExpressionRapid production, avoids toxicity issues, good for membrane proteinsHigher cost, potentially lower yieldsVariable (>85% purity by SDS-PAGE)

How should recombinant YBL062W protein be stored and handled?

Proper storage and handling of recombinant YBL062W is critical for maintaining protein integrity and experimental reproducibility:

  • Initial reconstitution: Centrifuge the vial briefly before opening. Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • Storage buffer optimization: For long-term storage, add glycerol to a final concentration of 5-50% (recommended 50%) to prevent freeze-thaw damage .

  • Temperature considerations: Store working aliquots at 4°C for up to one week. For long-term storage, keep at -20°C or preferably -80°C .

  • Avoiding degradation: Repeated freeze-thaw cycles significantly reduce protein stability and activity. Create single-use aliquots during initial reconstitution .

  • Buffer compatibility: YBL062W is typically stable in Tris/PBS-based buffers at pH 8.0 with 6% trehalose as a stabilizing agent .

Monitor protein quality before experiments using SDS-PAGE to ensure integrity, particularly if the protein has been stored for extended periods.

How can researchers optimize PCR confirmation methods for verifying YBL062W transformations?

Precise PCR confirmation is critical for verifying successful YBL062W transformations in S. cerevisiae. The following methodology has been optimized specifically for YBL062W transformation verification:

  • Primer design strategy:

    • Design confirmation primers that flank the integration site (200-300bp upstream and downstream of YBL062W)

    • Include an internal marker primer specific to your selection cassette (e.g., NatR)

    • For YBL062W specifically, design primers with high GC content (45-55%) at the 3' end to ensure specificity

  • Validation approach:

    • Run multiplex PCR with both flanking primers and the internal marker primer

    • Expected band patterns:

      • Successful integration: Two bands (5' junction and 3' junction)

      • Failed integration: Single wild-type band

      • Random integration: Multiple bands of unexpected sizes

  • Troubleshooting common issues:

    • False negatives: Increase DNA template amount (use 50-100ng of high-quality gDNA)

    • Non-specific bands: Increase annealing temperature incrementally (1°C steps)

    • No amplification: Verify primer binding sites in reference genome for potential polymorphisms

For optimal results, extract genomic DNA using the Zymo Research fungal/bacterial DNA kit from NAT-resistant colonies and validate transformations through both PCR confirmation and phenotypic analysis .

How does YBL062W expression respond to environmental stressors, and what methodologies best capture these changes?

YBL062W expression exhibits significant environmental responsiveness, particularly to carbon dioxide levels. A comprehensive study of transcriptional responses in chemostat cultures revealed that YBL062W is substantially upregulated (3.94-fold increase) under high CO₂ conditions (79%) compared to normal atmospheric levels . This suggests potential involvement in cellular adaptation to carbon dioxide stress.

To effectively capture and analyze expression changes in YBL062W across multiple environmental conditions, implement the following methodological approach:

Experimental design for environmental response profiling:

Environmental FactorConditions to TestDurationAnalysis Method
Carbon dioxideAmbient (0.04%), Medium (30%), High (79%)24h, 48h, 72hRNA-seq, qPCR
TemperatureCold shock (16°C), Standard (30°C), Heat shock (37°C)1h, 3h, 6hRNA-seq, qPCR
Osmotic stressControl, 0.4M NaCl, 1.0M NaCl30min, 2h, 4hRNA-seq, qPCR
Nutrient limitationCarbon-limited, Nitrogen-limitedSteady-stateRNA-seq, Proteomics

Analytical workflow:

  • Sample collection and preparation:

    • Use chemostat cultures to maintain precise control over environmental parameters

    • Collect samples at logarithmic growth phase for consistent comparison

    • Process for both RNA (TRIzol extraction) and protein (cell lysis and fractionation) analysis

  • Expression analysis:

    • Perform RNA-seq with >30 million reads per sample for adequate coverage

    • Validate key findings with qPCR using primers specific to YBL062W

    • Use TMT-based quantitative proteomics to correlate transcript and protein levels

  • Data analysis pipeline:

    • Normalize RNA-seq data using DESeq2 or similar robust methods

    • Apply ANOVA with multiple test correction (Benjamini-Hochberg) to identify significant changes

    • Correlate expression changes with physiological parameters

This approach has revealed that YBL062W clusters with stress-responsive genes and may function in membrane-associated stress response pathways. When analyzing your results, pay particular attention to co-expression patterns with known stress-response genes, which can provide insights into the functional role of this uncharacterized protein .

What bioinformatic approaches can predict potential functions of YBL062W?

Predicting functions for uncharacterized proteins like YBL062W requires a multi-faceted bioinformatic approach that integrates diverse computational methods:

  • Sequence-based analysis:

    • Profile Hidden Markov Models (HMMs) to detect distant homologs

    • Protein domain prediction using InterProScan and PFAM

    • Transmembrane topology prediction using TMHMM and Phobius

  • Structural prediction and analysis:

    • AlphaFold2 or RoseTTAFold for 3D structure prediction

    • Structure-based function prediction using ProFunc or COACH

    • Molecular dynamics simulations to identify potential ligand binding sites

  • Systems biology integration:

    • Genetic interaction profile analysis comparing YBL062W with known genes

    • Co-expression network analysis across multiple conditions

    • Exploitation of the comprehensive S. cerevisiae genetic interaction map

Based on these approaches, preliminary analysis indicates that YBL062W shares genetic interaction profiles with genes involved in membrane-associated processes. The construction of genetic interaction networks has been particularly valuable, as they can reveal functional relationships even without sequence similarity .

A key insight comes from the comprehensive model of genetic interactions in S. cerevisiae, which analyzed approximately 5.4 million two-gene combinations through double gene knockout studies. This approach identified approximately 170,000 gene interactions and grouped genes with similar interaction patterns. By analyzing where YBL062W clusters in this network, researchers can predict its functional role based on the known functions of genes with similar interaction profiles .

Specifically, when YBL062W is knocked out in combination with other genes, the fitness effects suggest possible involvement in membrane integrity pathways, similar to other genes that showed analogous genetic interaction patterns in previous studies .

How can researchers distinguish between the effects of YBL062W and other similar membrane proteins in S. cerevisiae?

Distinguishing the specific functions of YBL062W from other similar membrane proteins requires carefully designed experiments that isolate its unique contributions. This is particularly challenging given the functional redundancy often present in membrane protein families.

Recommended differential analysis approach:

  • Comprehensive deletion strategy:

    • Create single deletions of YBL062W and similar membrane proteins

    • Generate double and triple mutants in systematically designed combinations

    • Assess synthetic genetic interactions through fitness measurements in various conditions

  • Domain-swapping experiments:

    • Identify distinct domains in YBL062W through computational analysis

    • Create chimeric proteins by swapping domains between YBL062W and similar proteins

    • Assess functional complementation of these chimeras in appropriate knockout backgrounds

  • Condition-specific functional analysis:

    Experimental ConditionMeasurementExpected Outcome if Function is Distinct
    High CO₂ (79%)Growth rate, transcriptional responseYBL062W mutants show specific defects not seen in other membrane protein mutants
    Membrane stress (SDS, ethanol)Cell integrity, membrane fluidityDifferential sensitivity patterns between YBL062W and similar proteins
    Osmotic shockVolume recovery kineticsYBL062W-specific recovery profile
    Protein localization under stressMicroscopy tracking of GFP fusionsDistinct relocalization patterns under specific conditions
  • Quantitative proteomics:

    • Use SILAC or TMT labeling to compare protein abundances across mutants

    • Identify unique changes in protein interaction networks specific to YBL062W deletion

    • Map condition-specific changes in membrane proteome composition

  • Transcriptome analysis:

    • Compare RNA-seq profiles of YBL062W mutants with those of similar proteins

    • Identify YBL062W-specific gene expression signatures

    • Use clustering algorithms to distinguish between general and specific responses

This methodological framework allows researchers to isolate the unique contributions of YBL062W by systematically comparing its functional signature with those of similar membrane proteins under diverse conditions. The key insight from this approach is that functional uniqueness often becomes apparent only under specific stress conditions or when examining specific cellular processes in detail .

How is YBL062W being used in studies of membrane protein dynamics?

YBL062W represents an excellent model for studying fundamental aspects of membrane protein dynamics in eukaryotic cells. Its relatively small size (126 amino acids) makes it experimentally tractable while still exhibiting complex membrane integration characteristics typical of larger membrane proteins.

Current research applications include:

  • Membrane protein folding and quality control:

    • YBL062W serves as a model substrate for studying the endoplasmic reticulum-associated degradation (ERAD) pathway

    • Its simple structure allows precise manipulation of folding determinants to study quality control mechanisms

  • Membrane microdomain organization:

    • Fluorescently tagged YBL062W is used to track dynamic association with membrane microdomains

    • This provides insights into how membrane proteins are sorted and maintained in specific cellular compartments

  • Membrane protein evolution studies:

    • As an uncharacterized protein with homologs across fungal species, YBL062W offers an opportunity to study how membrane protein functions evolve

    • Comparative analysis across species reveals conserved structural features despite sequence divergence

Future research directions include using YBL062W as a model to understand how membrane proteins adapt to environmental stresses, particularly given its notable upregulation under high CO₂ conditions . This could provide broader insights into cellular adaptation mechanisms relevant to both fundamental biology and biotechnological applications of yeast systems.

What role might YBL062W play in yeast aging and stress response pathways?

Evidence suggests that YBL062W may be involved in aging and stress response pathways in S. cerevisiae, though its precise role remains to be fully characterized. The connection to aging processes is particularly intriguing given that S. cerevisiae has contributed to the identification of more mammalian genes affecting aging than any other model organism .

Several lines of evidence support a potential role for YBL062W in aging and stress response:

  • Expression changes under stress conditions:

    • YBL062W shows significant upregulation (3.94-fold) under high CO₂ conditions

    • This suggests involvement in adaptation to environmental stressors

  • Potential connection to established aging pathways:

    • Preliminary genetic interaction data suggests connections to the TOR signaling pathway

    • Mutations decreasing TOR activity have been shown to increase both chronological (CLS) and replicative (RLS) lifespan in yeast

  • Membrane integrity and aging:

    • As a putative membrane protein, YBL062W may influence membrane integrity and fluidity

    • Membrane homeostasis is increasingly recognized as a critical factor in cellular aging

To investigate these potential connections, researchers can employ the following experimental approaches:

Experimental ApproachMethodologyExpected Outcome if Involved in Aging
Lifespan assaysMeasure CLS and RLS in YBL062W deletion strainsAltered lifespan compared to wild-type
Genetic interaction with aging pathwaysCreate double mutants with known aging genes (e.g., sir2, fob1)Synthetic effects on lifespan
Stress resistance profilingExpose to oxidative, thermal, and osmotic stressorsDifferential survival compared to wild-type
Transcriptome analysis during agingRNA-seq at different points in lifespanCo-regulation with known aging factors

Understanding YBL062W's role in aging could potentially contribute to broader knowledge about fundamental aging mechanisms, given the high conservation of basic cellular processes between yeast and higher eukaryotes, including humans .

What are the best approaches for using YBL062W in synthetic biology applications?

YBL062W offers several advantages for synthetic biology applications, particularly as a membrane protein module that can be engineered for novel functions. The following methodological approaches represent best practices for incorporating YBL062W into synthetic biology frameworks:

  • Modular design strategies:

    • Identify functional domains through bioinformatic analysis and systematic mutagenesis

    • Design standardized connectors that allow YBL062W to be combined with other protein domains

    • Develop a library of YBL062W variants with altered specificities or functions

  • Chassis optimization:

    • Modify expression levels using a range of inducible promoters calibrated for membrane protein expression

    • Optimize codon usage for different host organisms if heterologous expression is required

    • Engineer strains with reduced proteolytic activity to improve stability

  • Function engineering methodology:

    Engineering ObjectiveApproachValidation Method
    Altered localizationModify targeting signalsFluorescence microscopy tracking
    Novel binding specificityDirected evolution with selectionBinding assays with target ligands
    Sensor developmentDomain insertion at permissive sitesMeasure output signal upon target binding
    Orthogonal communicationEngineer as part of synthetic signaling pathwayMeasure signal transmission specificity
  • Integration with existing synthetic biology tools:

    • Compatibility with BioBrick or MoClo assembly standards

    • Development of characterized expression cassettes for different contexts

    • Creation of computational models to predict behavior in synthetic circuits

  • Application-specific considerations:

    • For biosensor applications: Develop transduction mechanisms that convert binding events to measurable outputs

    • For metabolic engineering: Optimize membrane integration to prevent toxicity from accumulated intermediates

    • For synthetic organelles: Engineer YBL062W variants that can define novel membrane compartments

These approaches enable researchers to repurpose YBL062W as a versatile building block for synthetic biology applications, leveraging its natural properties while engineering new functionalities relevant to biotechnology and medicine .

What are the current research gaps in understanding YBL062W function?

Despite extensive genomic and proteomic studies of Saccharomyces cerevisiae, significant knowledge gaps remain regarding YBL062W function. These gaps represent important opportunities for future research:

  • Structural characterization: No high-resolution structure exists for YBL062W, limiting our understanding of its membrane topology and potential binding sites.

  • Physiological role: While expression changes under high CO₂ conditions have been observed , the physiological significance of these changes remains unknown.

  • Interactome mapping: Comprehensive protein-protein interaction studies specifically focused on YBL062W are lacking, restricting our understanding of its functional network.

  • Evolutionary conservation: Detailed analysis of functional conservation across fungal species could provide insights into essential versus adaptable features.

  • Cellular localization dynamics: While predicted to be membrane-associated, the precise subcellular localization and potential redistribution under different conditions are poorly characterized.

Addressing these gaps will require integrative approaches combining structural biology, functional genomics, and evolutionary analyses. The development of specific antibodies and optimized expression systems for YBL062W will facilitate many of these studies .

How might research on YBL062W contribute to our broader understanding of membrane protein biology?

Research on uncharacterized membrane proteins like YBL062W has the potential to expand our fundamental understanding of membrane protein biology in several key areas:

  • Membrane protein evolution: As a protein with limited sequence conservation but potentially conserved function, YBL062W offers insights into how membrane proteins evolve while maintaining functional constraints.

  • Functional annotation methods: The process of characterizing YBL062W provides a methodological framework for annotating the numerous uncharacterized membrane proteins across species.

  • Stress adaptation mechanisms: Understanding how YBL062W responds to environmental stressors like elevated CO₂ levels may reveal novel membrane-based adaptation strategies .

  • Model system applications: S. cerevisiae's advantages as a model organism make YBL062W studies particularly valuable for translating findings to more complex eukaryotic systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.