Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YGR290W (YGR290W)

Shipped with Ice Packs
In Stock

Description

Introduction

Saccharomyces cerevisiae, commonly known as baker's yeast, serves as a pivotal eukaryotic model organism in recombinant protein expression, particularly for integral membrane proteins (IMPs) . This yeast combines the benefits of unicellular organisms, such as rapid growth and ease of genetic manipulation, with the ability to perform eukaryotic post-translational modifications . S. cerevisiae expression systems are cost-effective, achieve high cell densities rapidly, yield high protein levels, and are generally recognized as safe (GRAS) .

General Information

Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YGR290W (YGR290W) is a protein that, as its name suggests, has not yet been fully characterized . The YGR290W protein is a putative membrane protein, implying it is likely located within the cell membrane . Proteins of this type are produced using recombinant DNA technology in Saccharomyces cerevisiae .

Characteristics

  • Purity Recombinant YGR290W typically has a purity level of ≥ 85% as determined by SDS-PAGE .

  • Amino Acid Sequence The protein consists of 147 amino acids .

  • Membrane Protein YGR290W is a membrane protein . Membrane proteins are crucial for various cellular processes, including transport, signaling, and maintaining cell structure .

  • Uncharacterized Function As an uncharacterized protein, the precise function of YGR290W in S. cerevisiae is not yet known . Further research is needed to elucidate its specific role in cellular mechanisms.

Recombinant Production

The production of recombinant YGR290W involves cloning the YGR290W gene into an expression vector, transforming S. cerevisiae with this vector, and culturing the yeast under conditions that promote protein expression . The recombinant protein is then isolated and purified for use in research .

Potential Functions and Significance

Given that YGR290W is a membrane protein, it may be involved in various cellular processes :

  • Membrane integrity and adaptation Membrane proteins play roles in maintaining the flexibility and homeostasis of the plasma membrane, which is essential for cell survival under stress conditions .

  • Response to environmental changes Some proteins are involved in the response to alkaline and neutral pH and other environmental conditions .

  • Mitochondrial Transport Some uncharacterized yeast proteins have been found to be mitochondrial carrier proteins, facilitating the transport of essential molecules within the mitochondria .

  • ER-PM Contact Sites Some uncharacterized proteins are targeted to the endoplasmic reticulum (ER) and plasma membrane (PM) contact sites, suggesting a role in membrane communication and signaling .

Research Techniques

Common techniques used to study YGR290W may include:

  • SDS-PAGE To determine the purity and molecular weight of the recombinant protein .

  • Mass spectrometry To confirm the identity and post-translational modifications of the protein.

  • Western blotting To detect the protein in cell lysates and membrane fractions.

  • Lipid Composition Analysis Analyzing the lipid composition of S. cerevisiae membranes to understand how YGR290W interacts with different lipids .

  • Microscopy To observe the localization of the protein within the cell .

  • Mutant Studies Creating knockout or mutant strains of S. cerevisiae to study the effects of YGR290W on cellular processes .

  • Transcriptome Sequencing RNA-seq can identify changes in gene expression related to YGR290W function .

Tables

PropertyDescription
NameRecombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YGR290W (YGR290W)
OrganismSaccharomyces cerevisiae
Protein TypePutative uncharacterized membrane protein
Purity≥ 85% by SDS-PAGE
Amino Acid Length147 aa
Potential FunctionsMembrane integrity, response to environmental changes, mitochondrial transport, ER-PM contact sites
Common Research TechniquesSDS-PAGE, Mass spectrometry, Western blotting, Microscopy, Mutant studies, Transcriptome Sequencing

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for tailored preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
YGR290W; Putative uncharacterized membrane protein YGR290W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-147
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YGR290W
Target Protein Sequence
MDHRAAFGYFSNACFKVMLFSSLLASFASSVAFISLITFSLSSSESPNWAELVVNSKWSS SKALSFFPSSKSSVLKTSCWFTISLEDSEMFLSSFFEAAFFLLTNEMIFFILYYFFSCLM FFYVASERNTNPKILQTINTKPLYIKN
Uniprot No.

Target Background

Database Links

STRING: 4932.YGR290W

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the basic structural characteristics of YGR290W protein?

YGR290W is a putative uncharacterized membrane protein from Saccharomyces cerevisiae with a full length of 147 amino acids . As an integral membrane protein, it likely contains hydrophobic transmembrane domains that anchor it within cellular membranes. While its tertiary structure has not been fully characterized, recombinant versions are available with His-tags for purification purposes .

The protein's uncharacterized status means it represents part of the "dark matter" of the protein universe - proteins whose structures and functions remain largely unknown despite their conservation in genomes. Recent advances in structural prediction using tools like AlphaFold may provide insights into its potential folding patterns, though these would require experimental validation .

What expression systems are most effective for producing recombinant YGR290W?

For expression of YGR290W, Saccharomyces cerevisiae itself represents an excellent homologous expression system. S. cerevisiae offers several advantages for membrane protein expression, including:

  • The capacity to perform proper eukaryotic post-translational modifications

  • Correct folding and targeting of integral membrane proteins (IMPs)

  • Cost-effective growth conditions and rapid attainment of high cell densities

  • The convenience of episomal expression plasmids and positive transformant selection

For optimal expression, protocols typically involve selection of appropriate promoters (such as GAL1 for inducible expression), optimization of growth conditions, and careful consideration of tags that facilitate detection and purification without interfering with protein folding or function .

How can researchers optimize YGR290W expression in Saccharomyces cerevisiae?

Optimizing expression of integral membrane proteins like YGR290W in S. cerevisiae requires careful consideration of several experimental parameters:

  • Strain selection: Strains with reduced protease activity (e.g., BJ5464) or modified secretory pathways can improve membrane protein yields.

  • Vector design: Episomal plasmids with appropriate copy numbers and promoters should be selected. For YGR290W, consider:

    • Inducible promoters (GAL1) for controlled expression

    • Constitutive promoters (PGK1, TDH3) for continuous expression

    • CEN/ARS plasmids for low copy number or 2μ for high copy number

  • Growth conditions optimization:

    • Temperature: Lower temperatures (20-25°C) may improve folding

    • Media composition: Rich medium (YPD) for biomass generation followed by induction in selective medium

    • Induction timing: Induce at mid-log phase for optimal expression

  • Protein extraction strategies:

    • Gentle mechanical disruption methods (glass beads)

    • Appropriate detergent selection for membrane solubilization

    • Buffer optimization to maintain protein stability

Systematic testing of these variables in factorial designs is recommended to identify optimal conditions for YGR290W expression.

What approaches are most effective for structural characterization of YGR290W?

Structural characterization of an uncharacterized membrane protein like YGR290W presents significant challenges. A multi-tiered approach is recommended:

  • Computational prediction and analysis:

    • Sequence-based prediction of transmembrane domains

    • AlphaFold or similar tools for tertiary structure prediction

    • Comparison with structural databases through tools like Foldseek

  • Experimental approaches:

    • Circular dichroism (CD) spectroscopy for secondary structure analysis

    • Limited proteolysis to identify domain boundaries

    • Crosslinking studies to identify potential interaction interfaces

    • X-ray crystallography or cryo-EM for high-resolution structure determination, though these typically require significant protein amounts and optimization

  • Comparative structural analysis:

    • Structure comparison with characterized membrane proteins from similar families

    • Template modeling (TM) scoring to evaluate structural similarities

Given that YGR290W is uncharacterized, researchers should first establish basic structural features before attempting more resource-intensive high-resolution structural studies.

How can researchers determine if YGR290W belongs to a known protein family?

Determining the potential family membership of YGR290W requires a systematic approach combining sequence and structural analyses:

  • Sequence-based approaches:

    • Multiple sequence alignment with characterized proteins

    • Hidden Markov Model (HMM) searches using HHPred

    • Construction of sequence similarity networks to visualize relationships between YGR290W and other proteins

  • Structure-based approaches:

    • Comparison of predicted structural models with known structures using tools like Foldseek

    • Evaluation of template modeling (TM) scores to quantify structural similarity

    • Analysis of conserved structural motifs characteristic of specific protein families

  • Functional inference:

    • Identification of conserved motifs associated with specific biochemical activities

    • Comparison with proteins of known function from the same genomic context

For example, the approach used in analyzing component 27 in search result revealed that proteins initially annotated as uncharacterized could be linked to well-studied superfamilies of transmembrane oligosaccharyl- and glycosyltransferases through combined sequence and structural analysis .

What experimental approaches can determine YGR290W function?

Since YGR290W is putatively uncharacterized, a systematic approach to functional characterization is necessary:

  • Genetic approaches:

    • Gene knockout/knockdown studies to observe phenotypic changes

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • Complementation studies in deletion strains

    • Integration into the synthetic yeast genome (Sc2.0) with inducible control elements

  • Biochemical approaches:

    • Activity assays based on predicted functions from structural homology

    • Substrate screening using metabolite libraries

    • Protein-protein interaction studies (Y2H, co-IP, BioID)

    • Localization studies using GFP-fusion proteins to determine subcellular distribution

  • Systems biology approaches:

    • Transcriptomic analysis to identify co-regulated genes

    • Metabolomic profiling to identify affected pathways

    • Network analysis to place YGR290W in functional context

For membrane proteins like YGR290W, it's particularly important to consider its potential role in transport, signaling, or cell wall/membrane maintenance functions common to yeast membrane proteins.

How should researchers design controls when studying YGR290W function?

Proper experimental controls are essential for reliable results when studying uncharacterized proteins like YGR290W:

  • Negative controls:

    • YGR290W deletion strain to verify phenotypes

    • Empty vector transformants to control for plasmid effects

    • Inactive YGR290W mutants (e.g., site-directed mutations in predicted active sites)

    • Non-relevant membrane protein expression for specificity determination

  • Positive controls:

    • Well-characterized membrane proteins with similar predicted structures

    • Known proteins from the same family if homology is established

    • Complementation with wild-type YGR290W in knockout strains

  • Technical controls:

    • Multiple independent transformants to control for clonal variation

    • Time course studies to establish kinetics of observed effects

    • Dose-dependent analyses when using inducible expression systems

These controls ensure that observed phenotypes or biochemical activities can be specifically attributed to YGR290W rather than experimental artifacts or general effects of membrane protein overexpression .

What considerations are important when designing experiments to resolve contradictory data about YGR290W?

When faced with contradictory data regarding YGR290W function or characteristics, a systematic troubleshooting approach is necessary:

  • Source of contradiction identification:

    • Expression level variations across experimental systems

    • Differences in strain backgrounds or growth conditions

    • Variations in protein tags or fusion partners affecting function

    • Differences in assay conditions or detection methods

  • Experimental design for resolution:

    • Standardization of expression systems and growth conditions

    • Comparison of multiple detection methods for the same phenotype

    • Side-by-side testing of contradictory conditions in a single experiment

    • Testing both N- and C-terminal tagged versions to identify tag interference

  • Statistical validation:

    • Increased biological and technical replicates

    • Appropriate statistical tests to evaluate significance of differences

    • Power analysis to ensure sufficient sample sizes

  • Independent method validation:

    • Use orthogonal techniques to confirm observations

    • Consider whether observed contradictions might reveal condition-specific functions

For example, if contradictory results are observed regarding amino acid utilization patterns related to YGR290W function, this could reflect genuine biological complexity similar to that mentioned in search result , where contradictions between amino acid abundance and utilization were observed in yeast studies .

How can researchers effectively analyze YGR290W in the context of synthetic yeast genome projects?

Analyzing YGR290W in the context of the Sc2.0 synthetic yeast genome project requires specialized approaches:

  • Design considerations:

    • Incorporation of standardized recoding principles consistent with Sc2.0 design

    • Addition of synthetic control elements such as loxP sites for SCRaMbLE inducible evolution

    • Codon optimization while maintaining regulatory sequences

    • Potential telomeric or subtelomeric relocations to test positional effects

  • Analytical approaches:

    • Comparative phenotypic analysis between native and synthetic strains

    • Testing fitness effects of YGR290W modifications in synthetic backgrounds

    • Combining SCRaMbLE with selection to evolve novel YGR290W functions

    • High-throughput screening of synthetic variants

  • Integration with Sc2.0 resources:

    • Utilization of "Build A Genome" course resources for YGR290W synthesis

    • Coordination with international Sc2.0 consortium for standardized protocols

    • Application of debugging protocols established for synthetic chromosomes

The Sc2.0 project provides a unique framework for studying YGR290W function through designed perturbations and evolutionary approaches in a synthetic genomic context .

What high-throughput methods can be applied to study YGR290W interactions and functions?

Several high-throughput methods are particularly valuable for studying uncharacterized membrane proteins like YGR290W:

  • Interactome analysis:

    • Split-ubiquitin membrane yeast two-hybrid (MYTH)

    • Proximity labeling approaches (BioID, APEX)

    • Systematic co-immunoprecipitation with membrane proteome

    • Cross-linking mass spectrometry (XL-MS) for capturing transient interactions

  • Functional genomics:

    • CRISPR interference/activation for modulating YGR290W expression

    • Barcode-based parallel phenotypic analysis

    • Chemical genomics to identify compounds affecting YGR290W-dependent phenotypes

    • Synthetic genetic array (SGA) analysis in various growth conditions

  • Systems-level analysis:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Network analysis to place YGR290W in functional context

    • Flux balance analysis to identify metabolic impacts

These approaches allow researchers to rapidly generate testable hypotheses about YGR290W function that can then be validated through more targeted experimental approaches.

How can flow cytometry be applied to study YGR290W function in Saccharomyces cerevisiae?

Flow cytometry offers powerful approaches for analyzing YGR290W at the single-cell level:

  • Sample preparation protocol:

    • Grow cells in appropriate medium (e.g., GPY) at 28°C for 48h

    • Harvest approximately 1×10^6 cells by centrifugation (4000 × g for 5 min)

    • Wash with 1× PBS buffer and add 2 μL Tween 80 to prevent aggregation

    • Fix cells with cold 70% ethanol and incubate at -20°C for at least 30 minutes

    • Wash with PBS and resuspend in PBS containing RNA degrading enzymes

  • Applications for YGR290W analysis:

    • Cell cycle analysis to detect alterations in cell division

    • Membrane integrity assessment using appropriate dyes

    • Protein localization using fluorescent fusion proteins

    • Measurement of membrane potential or ion flux if YGR290W functions as a transporter

    • Quantification of cell surface modifications if YGR290W affects cell wall integrity

  • Data analysis considerations:

    • Single-cell resolution allows identification of subpopulations

    • Multiparameter analysis to correlate YGR290W function with cellular phenotypes

    • Time-course studies to capture dynamic processes

Flow cytometry provides quantitative, high-throughput analysis that can detect subtle phenotypes potentially missed by population-level assays.

What are the most challenging aspects of YGR290W research and how can researchers overcome them?

Research on uncharacterized membrane proteins like YGR290W presents several significant challenges:

  • Expression and purification challenges:

    • Low natural expression levels

    • Potential toxicity when overexpressed

    • Difficulty in extracting and purifying membrane proteins

    Solutions:

    • Use of inducible promoters with fine-tuned expression levels

    • Optimization of detergent screening for extraction

    • Development of fusion partners that enhance stability

    • Application of nanodiscs or other membrane mimetics for stabilization

  • Functional annotation challenges:

    • Absence of obvious homologs with known function

    • Limited phenotypes in standard conditions

    • Potential redundancy with other proteins

    Solutions:

    • Testing function under diverse stress conditions

    • Creating synthetic genetic interactions through double mutants

    • Applying sensitive reporter systems to detect subtle phenotypes

    • Using computational inference from interaction networks

  • Structural characterization challenges:

    • Difficulty in obtaining sufficient quantities for structural studies

    • Challenges in crystallizing membrane proteins

    • Potential structural flexibility

    Solutions:

    • Employing cryo-EM for structural determination

    • Using AlphaFold or similar tools for initial structure prediction

    • Focusing on specific domains that may be more amenable to analysis

    • Applying integrative structural biology approaches

By systematically addressing these challenges, researchers can make significant progress in understanding this putative uncharacterized membrane protein.

What is the current state of knowledge about YGR290W and related uncharacterized membrane proteins?

YGR290W remains largely uncharacterized, representing one of many membrane proteins in the yeast proteome with unclear functions. Current knowledge is limited to basic information about its sequence length (147 amino acids) and its classification as a putative membrane protein . The protein lacks comprehensive functional annotation, clearly defined interacting partners, or established phenotypes associated with its absence or overexpression.

This knowledge gap is representative of a broader challenge in understanding the "dark matter" of the protein universe - proteins that persist in genomes but whose functions remain elusive . Recent advances in structural prediction using AlphaFold and similar tools offer new opportunities to generate hypotheses about potential functions based on structural similarities to better-characterized proteins.

Future research should focus on systematic characterization using the methodologies outlined in the previous sections, with particular emphasis on integrating computational predictions with experimental validation.

How might YGR290W research contribute to the broader understanding of membrane proteins in eukaryotes?

Research on uncharacterized membrane proteins like YGR290W has potential to advance several areas:

  • Expanding the known membrane protein functional repertoire:

    • Discovery of novel membrane protein functions and mechanisms

    • Identification of new protein families and folds

    • Better understanding of membrane protein evolution

  • Advancing synthetic biology applications:

    • Incorporation of novel membrane components into the Sc2.0 synthetic genome

    • Development of new biosensors or cellular engineering tools

    • Enhancement of yeast as a platform for heterologous membrane protein expression

  • Improving computational prediction tools:

    • Providing validation data for structure prediction algorithms

    • Refining transmembrane topology prediction methods

    • Enhancing functional annotation based on structural predictions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.