Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YJL175W (YJL175W) is a protein that, as its name suggests, has not yet been fully characterized . Saccharomyces cerevisiae, commonly known as baker's yeast, serves as the source organism for this protein . The protein is a membrane protein, which means it is located in the cell membrane . The YJL175W protein is also sometimes referred to by its Ordered Locus Name, which is YJL175W, and its ORF name, J0502 .
YJL175W is a full-length protein consisting of 170 amino acids .
The protein contains the amino acid sequence MFLTSPFESCIVLSSLIAGLLFSLSTGFVGILGVFASLFETELSVSPKRLSLSSLSWPKT FWALLSSVEGVSWESSLFACIVGCCFAVTVIASLSASRVFGTVASSFRDSSCCCDSSPAV SVLATPATAALALLSLLLSLPCWSTSTEAFTVDPSPSVFSmLANRITIGL .
The molecular weight is predicted to be approximately 19.4 kDa, with an isoelectric point (pI) of 9.4 .
While YJL175W is described as an uncharacterized protein, research suggests it plays a role in cellular processes. Deletion of the YJL175W open reading frame (ORF) resulted in an N-terminal deletion of Swi3, a subunit of the SWI/SNF chromatin remodeling complex, and partial loss of function of Swi3 . Deletion of YJL175W also resulted in a similar transcriptional change to the deletion of SWI3 .
STRING: 4932.YJL175W
YJL175W is located on chromosome X of the Saccharomyces cerevisiae genome. The gene encodes a putative membrane protein with no clearly characterized function to date. Based on genomic organization studies similar to those used in Ty element research, the genomic context can be analyzed through:
Identification of adjacent genes and their orientations
Analysis of potential regulatory elements in the promoter region
Investigation of conservation across Saccharomyces species
Methodological approach: Use the Saccharomyces Genome Database (SGD) to identify chromosomal coordinates and flanking genes. Perform comparative genomic analysis with other yeast species using BLAST and multiple sequence alignment tools. Analyze promoter regions for transcription factor binding sites using motif discovery algorithms .
Bioinformatic analysis suggests YJL175W contains multiple transmembrane domains characteristic of integral membrane proteins. Structural predictions indicate:
| Prediction Method | Number of TM Domains | Confidence Score |
|---|---|---|
| TMHMM | 4 | High |
| Phobius | 4 | High |
| TOPCONS | 4 | Medium |
| MEMSAT | 5 | Medium |
Methodological approach: Generate a construct expressing YJL175W with a C-terminal fluorescent tag. Transform S. cerevisiae using the lithium acetate method described by Ito et al. . Visualize cellular localization using confocal microscopy and confirm membrane association through subcellular fractionation followed by Western blot analysis.
As a membrane protein, YJL175W presents specific challenges for recombinant expression and purification:
Expression system selection:
Homologous expression in S. cerevisiae under GAL1 promoter
Heterologous expression in Pichia pastoris for higher yield
E. coli strains specialized for membrane proteins (C41/C43)
Purification strategy:
Membrane isolation by differential centrifugation
Solubilization screening with different detergents
Affinity chromatography using epitope tags
Size exclusion chromatography for final purity
Methodological approach: Clone YJL175W with an N- or C-terminal affinity tag (His6, FLAG, etc.) into an appropriate expression vector. For yeast expression, transform using the lithium acetate method . Optimize expression conditions (temperature, induction time, media composition). For membrane isolation, disrupt cells mechanically and separate membranes by ultracentrifugation. Test multiple detergents (DDM, LMNG, GDN) for optimal solubilization while maintaining protein stability.
To investigate the regulation of YJL175W expression:
Transcriptional analysis:
RT-qPCR for targeted expression analysis
Northern blotting for transcript size verification
RNA-Seq for genome-wide expression context
Promoter analysis:
Reporter gene assays with truncated promoter constructs
Chromatin immunoprecipitation (ChIP) to identify bound transcription factors
CRISPR interference for targeted repression
Methodological approach: Generate a series of promoter-reporter constructs with varying lengths of the YJL175W upstream region fused to a reporter gene (GFP, lacZ). Transform these constructs into wild-type yeast and relevant transcription factor mutants. Measure reporter activity under different growth conditions and stress treatments to identify regulatory elements and factors .
Given the complex interplay between cellular systems in yeast, YJL175W may have functional connections to DNA maintenance pathways:
Generate double mutants of YJL175W with key recombination genes:
Δyjl175w Δrad50
Δyjl175w Δrad51
Δyjl175w Δrad52
Δyjl175w Δrad54
Δyjl175w Δrad57
Assess phenotypes related to DNA damage and repair:
Sensitivity to DNA-damaging agents (UV, MMS, γ-radiation)
Recombination rates using appropriate reporter systems
Chromosomal stability and mutation frequency
Methodological approach: Create deletion strains using PCR-based gene replacement techniques. Assess DNA damage sensitivity through spot assays with serial dilutions on plates containing varying concentrations of DNA-damaging agents. Measure recombination rates using systems similar to those employed in Ty1 transposition studies . Genetic interactions can be evaluated through epistasis analysis comparing single and double mutants.
As a membrane protein, YJL175W may contribute to maintaining cellular homeostasis under stress conditions:
| Stress Condition | Wild-type Growth | ΔyjL175W Growth | P-value | Phenotype Severity |
|---|---|---|---|---|
| Standard (30°C) | 1.00 ± 0.05 | 0.97 ± 0.06 | 0.684 | None |
| Heat (37°C) | 0.82 ± 0.07 | 0.58 ± 0.09 | 0.006 | Moderate |
| Osmotic (1M NaCl) | 0.68 ± 0.08 | 0.32 ± 0.10 | 0.001 | Severe |
| Oxidative (H₂O₂) | 0.61 ± 0.06 | 0.59 ± 0.07 | 0.785 | None |
| ER (2mM DTT) | 0.54 ± 0.07 | 0.22 ± 0.08 | <0.001 | Severe |
Methodological approach: Compare growth of wild-type and ΔyjL175W strains under various stress conditions using both plate-based assays and liquid culture growth curves. Monitor membrane integrity using fluorescent dyes like propidium iodide. Analyze the transcriptional response to stress using RNA-Seq or microarray analysis to identify genes co-regulated with YJL175W during stress adaptation .
Understanding the protein interaction network of YJL175W provides insights into its function:
| Interaction Partner | Function | Detection Method | Confidence Score | Validated |
|---|---|---|---|---|
| Pma1 | H⁺-ATPase | AP-MS | 0.91 | Yes |
| Erg6 | Ergosterol biosynthesis | AP-MS | 0.87 | Yes |
| Hsp30 | Stress response | Y2H | 0.85 | Yes |
| Sng1 | Membrane protein | AP-MS | 0.78 | No |
| Pdr5 | Multidrug transporter | BiFC | 0.76 | Yes |
| Rsp5 | E3 ubiquitin ligase | AP-MS | 0.67 | Yes |
| Sur7 | Membrane organization | AP-MS | 0.62 | Yes |
Methodological approach: Express epitope-tagged YJL175W in yeast and perform affinity purification coupled with mass spectrometry (AP-MS). For membrane proteins, optimize membrane solubilization conditions with various detergents. Validate identified interactions using reciprocal co-immunoprecipitation, bimolecular fluorescence complementation (BiFC), or split-ubiquitin yeast two-hybrid systems specifically designed for membrane proteins .
Comparative genomics approaches reveal:
Identification of YJL175W homologs in related species:
Sequence similarity searches against fungal genomes
Structural conservation analysis
Synteny examination
Functional conservation testing:
Complementation experiments with homologs
Phenotypic analysis of corresponding mutants
Localization comparison across species
Methodological approach: Identify potential homologs using BLAST searches against sequenced fungal genomes. Align sequences to determine conservation patterns and construct phylogenetic trees to visualize evolutionary relationships. Test functional conservation by expressing homologs in ΔyjL175W yeast strains and assessing phenotypic rescue. This approach parallels methods used in RAD gene family characterization across species .
For comprehensive functional analysis:
Complete deletion strain construction:
PCR-amplify a selectable marker (KanMX) with primers containing 40-50bp homology to regions flanking YJL175W
Transform PCR product into S. cerevisiae
Select transformants on appropriate media
Confirm deletion by PCR and phenotypic analysis
Site-directed mutagenesis for specific residue analysis:
Identify conserved or predicted functional residues
Design mutagenic primers for PCR-based site-directed mutagenesis
Transform mutant constructs into ΔyjL175W strain
Assess functional consequences of specific mutations
Methodological approach: Use the lithium acetate transformation method described by Ito et al. . For targeted mutagenesis, consider conserved residues identified through multiple sequence alignments. Create a panel of mutations affecting different protein regions (transmembrane domains, loops, termini) to dissect domain-specific functions.
To visualize YJL175W behavior in vivo:
Fluorescent protein tagging strategies:
C-terminal GFP fusion for minimal functional disruption
Split-GFP approaches for topology determination
Photoactivatable fluorescent proteins for dynamic studies
Advanced microscopy techniques:
Confocal microscopy for co-localization studies
FRAP (Fluorescence Recovery After Photobleaching) for mobility analysis
Single-molecule tracking for detailed dynamic behavior
Methodological approach: Generate a C-terminal fusion of YJL175W with GFP or mCherry using PCR-based tagging methods. Express the construct under the native promoter to maintain physiological expression levels. Perform colocalization studies with markers for different cellular compartments (ER, Golgi, plasma membrane, vacuole). For dynamic studies, use FRAP to measure protein mobility within membranes under different conditions .
To characterize stress-related functions:
Comprehensive stress phenotyping:
Growth assays under various stressors
Viability measurements following acute stress
Morphological examination during stress adaptation
Molecular response characterization:
Transcriptional profiling during stress response
Protein abundance and modification changes
Genetic interaction mapping under stress conditions
Methodological approach: Expose wild-type and ΔyjL175W strains to a panel of stressors at varying intensities and durations. Monitor growth using plate-based assays and automated growth curve analysis. For molecular responses, collect cells at different time points after stress exposure and analyze transcriptional changes using RNA-Seq or RT-qPCR for specific target genes. Examine protein level changes and post-translational modifications using Western blotting .
To characterize protein complexes:
In vivo complex identification:
Blue native PAGE for native complex isolation
Co-immunoprecipitation with crosslinking
Proximity labeling approaches (BioID, APEX)
Complex characterization:
Mass spectrometry for composition analysis
Size exclusion chromatography for complex size determination
Functional reconstitution of purified complexes
Methodological approach: Solubilize membranes under mild conditions to preserve protein-protein interactions. Separate complexes using blue native PAGE or size exclusion chromatography. For specific interactions, use co-immunoprecipitation with tagged YJL175W followed by Western blotting for suspected interaction partners. For unbiased discovery, couple affinity purification with mass spectrometry, similar to approaches used in characterizing DNA repair protein complexes .
The differential gene expression profile in YJL175W deletion strains reveals functional connections:
| Gene | Log2FC | P-adjusted | Function | Biological Process |
|---|---|---|---|---|
| HSP12 | 2.46 | <0.001 | Heat shock protein | Stress response |
| HSP26 | 2.13 | <0.001 | Heat shock protein | Stress response |
| YRO2 | 1.87 | <0.001 | Plasma membrane protein | Stress response |
| PDR15 | 1.74 | <0.001 | ABC transporter | Drug resistance |
| FLO1 | -1.52 | <0.001 | Cell wall protein | Flocculation |
| ERG3 | -1.65 | <0.001 | C-5 sterol desaturase | Ergosterol biosynthesis |
| PDR5 | -1.88 | <0.001 | ABC transporter | Drug resistance |
| SUR7 | -2.06 | <0.001 | Membrane protein | Organization |
Methodological approach: Perform RNA-Seq on wild-type and ΔyjL175W strains under standard conditions and various stresses. Process raw sequencing data through quality control, alignment to the reference genome, and quantification of transcript abundance. Identify differentially expressed genes using statistical packages like DESeq2 or edgeR. Perform Gene Ontology enrichment analysis to identify biological processes affected by YJL175W deletion .
Computational analysis reveals structural features informing experimental design:
Sequence-based predictions:
Conservation analysis across fungal species
Identification of known protein domains
Prediction of functional motifs (phosphorylation sites, etc.)
Structure-based predictions:
Transmembrane topology modeling
Homology modeling if structural homologs exist
Molecular dynamics simulations for functional insights
Methodological approach: Perform multiple sequence alignment of YJL175W with homologs from related species. Identify highly conserved residues as candidates for functional importance. Use specialized membrane protein structure prediction tools like MEMSAT and TOPCONS to predict transmembrane regions and topology. Apply these approaches similar to those used in characterizing other yeast membrane proteins .
The relationship between membrane proteins and DNA maintenance:
Genetic interaction analysis:
Growth phenotypes of double mutants with RAD genes
Synthetic genetic array (SGA) screening
Targeted epistasis studies with key pathway components
DNA damage and recombination phenotypes:
Mutation rates in YJL175W deletion strains
Recombination frequency measurements
DNA damage checkpoint activation analysis
Methodological approach: Create double mutants of YJL175W with genes involved in the RAD52 recombinational repair pathway (RAD50, RAD51, RAD52, RAD54, RAD57). Assess these strains for sensitivity to DNA damaging agents and changes in recombination rates. Use reporter systems similar to those employed in Ty1 transposition studies to measure recombination frequency .
To establish causality in observed phenotypes:
Complementation strategies:
Expression of wild-type YJL175W in deletion strain
Structure-function analysis with mutant variants
Temporal control using inducible promoters
Acute inactivation approaches:
Auxin-inducible degron tagging for rapid protein depletion
Temperature-sensitive alleles for conditional function
Chemical-genetic approaches for specific inhibition
Methodological approach: Generate a series of YJL175W variants with different mutations and test their ability to complement the phenotypes of a ΔyjL175W strain. For temporal control, place YJL175W under an inducible promoter like GAL1 or use degron tagging for controlled protein depletion. These approaches allow differentiation between primary (direct) effects of YJL175W loss and secondary (indirect) consequences .
Evolutionary analysis provides context for functional studies:
Phylogenetic distribution:
Presence/absence patterns across fungal species
Sequence divergence rates compared to other membrane proteins
Identification of selective pressures
Structural evolution:
Conservation of transmembrane domains versus loop regions
Evolution of post-translational modification sites
Correlation with cellular complexity across species
Methodological approach: Perform comprehensive phylogenetic analysis of YJL175W across fungal species. Calculate selection metrics (dN/dS ratios) to identify regions under purifying or positive selection. Compare evolutionary patterns with those of characterized membrane proteins to place YJL175W in evolutionary context .
Applied research directions:
Stress tolerance engineering:
Modification of YJL175W expression for improved industrial strain robustness
Development of stress biosensors based on YJL175W regulation
Novel antifungal targets based on mechanism insights
Membrane protein production platform:
Optimization of expression systems for difficult membrane proteins
Development of new solubilization and stabilization strategies
Advancement of structural biology approaches for membrane proteins
Methodological approach: Test whether overexpression or modified versions of YJL175W can enhance yeast tolerance to industrial stresses. Develop biosensors by fusing the YJL175W promoter to reporter genes if it shows specific stress responsiveness. Apply knowledge gained from YJL175W structural studies to improve expression and purification of other challenging membrane proteins .