Recombinant Saccharomyces cerevisiae Putative uncharacterized membrane protein YNL109W (YNL109W)

Shipped with Ice Packs
In Stock

Description

Protein Identification and Basic Properties

YNL109W is officially designated as a "Putative uncharacterized membrane protein" in Saccharomyces cerevisiae, commonly known as baker's yeast . The protein is identified by its UniProt accession number P53928 and is also referenced by ordered locus name YNL109W and ORF name N1958 . The full-length protein consists of 181 amino acids, making it a relatively small membrane protein .

Genetic Context

The YNL109W gene is located on one of the Saccharomyces cerevisiae chromosomes. In some experimental contexts, such as the synthetic yeast genome project, this gene has been studied as part of larger chromosomal manipulations, particularly in research focusing on the three-dimensional organization of synthetic yeast chromosomes .

Expression Systems for YNL109W Production

Multiple expression systems have been developed for the recombinant production of YNL109W, enabling researchers to study this protein despite its natural low abundance. The primary expression systems include:

Expression HostFeaturesPurityProduct FormatReference
E. coliCommon bacterial expression system≥85% (SDS-PAGE)Recombinant protein
YeastNative or near-native environment≥85% (SDS-PAGE)Recombinant protein
BaculovirusInsect cell-based expression≥85% (SDS-PAGE)Recombinant protein
Mammalian CellAdvanced eukaryotic expression≥85% (SDS-PAGE)Recombinant protein
Cell-Free ExpressionNon-cellular synthesis system≥85% (SDS-PAGE)Recombinant protein

The cell-free expression system has particular advantages for transmembrane proteins like YNL109W, as it avoids potential toxicity issues that can occur when overexpressing membrane proteins in living cells . This approach has enabled the production of purified YNL109W for various research applications.

Available Product Formats

YNL109W is commercially available in several formats to serve different research needs:

  1. Full-length recombinant protein (1-181 amino acids)

  2. Partial recombinant protein fragments

  3. Antibodies against YNL109W (particularly rabbit polyclonal antibodies)

These products support various research applications, including protein-protein interaction studies, localization experiments, and functional characterization efforts.

Potential Functional Associations

While the specific function of YNL109W remains uncharacterized, several research contexts provide clues to its possible roles:

  1. Membrane transport: As a transmembrane protein, YNL109W may be involved in transport processes across the yeast cell membrane .

  2. Nutrient sensing: YNL109W has been mentioned in the context of nutrient sensing studies in Saccharomyces cerevisiae, suggesting a potential role in detecting or responding to environmental nutrients .

  3. Chromosome organization: In synthetic biology research, YNL109W has been studied within the context of chromosome manipulation experiments, particularly those focused on three-dimensional organization of synthetic yeast chromosomes .

Use in Synthetic Biology and Genome Engineering

YNL109W has been studied in the context of synthetic chromosome research, particularly in projects focused on constructing and manipulating synthetic versions of yeast chromosomes . This research has implications for understanding the three-dimensional organization of chromosomes and its effects on gene regulation.

One particularly interesting study mentioned in the search results involved manipulating the spatial structure of a synthetic yeast chromosome, which included the genomic region containing YNL109W . This work has provided insights into higher-order architectural design principles for synthetic genomes and demonstrated methods for chromosome-wide transcription manipulation.

Analytical Applications

Recombinant YNL109W and antibodies against this protein find applications in various analytical techniques:

TechniqueApplicationProduct Type UsedReference
ELISAProtein detection and quantificationRecombinant protein, antibodies
Western BlotProtein expression analysisAntibodies
Protein-Protein Interaction StudiesIdentification of binding partnersRecombinant protein
ImmunohistochemistryLocalization studiesAntibodies

These analytical applications contribute to ongoing efforts to better understand the functional role of YNL109W in yeast cellular processes.

Relevance to Amino Acid Sensing and Nutrient Response

Research on amino acid sensing pathways in yeast has revealed complex regulatory networks involving membrane proteins. While YNL109W's specific role in these pathways is not explicitly established, it has been mentioned in the context of studies on nutrient sensing in Saccharomyces cerevisiae . This suggests potential relevance to cellular processes related to amino acid transport or signaling, though direct experimental evidence for such functions remains to be established.

Functional Characterization Opportunities

The "uncharacterized" status of YNL109W presents numerous opportunities for future research, including:

  1. Targeted gene deletion or mutation studies to observe phenotypic effects

  2. Protein localization experiments using fluorescent tags or immunohistochemistry

  3. Interactome mapping to identify protein-protein interactions

  4. Transcriptomic and proteomic analyses under various growth conditions

  5. Structure determination through crystallography or cryo-electron microscopy

Potential Relevance to Biotechnology Applications

As a membrane protein in Saccharomyces cerevisiae, YNL109W could potentially be relevant to biotechnology applications involving this important industrial organism. Yeast membrane proteins often play crucial roles in stress response, nutrient uptake, and metabolite export—all processes relevant to industrial fermentation and bioproduction .

The availability of recombinant production systems for YNL109W facilitates further research into its potential biotechnological applications, particularly if future studies reveal functional roles related to industrially relevant processes.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by several factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of the specified tag.
Synonyms
YNL109W; N1958; Putative uncharacterized membrane protein YNL109W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-181
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL109W
Target Protein Sequence
MQKCIMRSTEFKTHFSFHSIFSFPLSAALLALISASEPASKAFINVQFISSPLVKKEVLP FIVSFHSLSSNGILSFSPFTSSNLSIAQLPFLIKVPLLSMGSLALENFNKFIPRADLVAA WVTIIMVFTFGNFLSTLSIKTGQNLWHLSKISSSVSPLLLGIILGSQSGEIMLGKNLLIT S
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant YNL109W typically expressed and purified for research purposes?

Recombinant YNL109W protein is typically produced using a cell-free expression system rather than traditional host cell expression methods . This approach is particularly suitable for membrane proteins like YNL109W that may be toxic to host cells when overexpressed. The purification process typically yields a product with ≥85% purity as determined by SDS-PAGE analysis .

The methodological workflow involves:

  • Cell-free protein synthesis using a reconstituted transcription-translation system

  • Addition of detergents or lipid nanodisc components during expression to stabilize the membrane protein

  • Affinity chromatography using histidine or other fusion tags

  • Size exclusion chromatography to remove aggregates and impurities

  • Quality control testing via gel electrophoresis and/or Western blotting

For storage, the protein is maintained in a liquid formulation containing glycerol at -20°C, with recommendations for longer-term storage at -80°C. Working aliquots should be kept at 4°C for no more than one week to maintain protein integrity .

What morphological and biochemical methods can be used to identify recombinant Saccharomyces cerevisiae expressing YNL109W?

Identification of Saccharomyces cerevisiae strains expressing recombinant YNL109W requires a multi-dimensional approach:

Morphological Identification:

  • Gram staining reveals Gram-positive, oval-shaped cells consistent with S. cerevisiae morphology

  • Microscopic examination will show both single cells and characteristic budding stages typical of yeast cell division

  • Phase contrast or differential interference contrast microscopy can be used to examine cell morphology without staining

Biochemical Confirmation:

  • Yeast-specific biochemical tests ("yeast plus") provide confirmation of S. cerevisiae identity

  • PCR amplification using YNL109W-specific primers can verify the presence of the gene

  • Western blotting using antibodies against YNL109W or epitope tags can confirm protein expression

Expression Verification:

  • Fluorescent tagging (e.g., GFP fusion) allows visualization of expression and localization

  • Quantitative PCR to measure transcript levels of YNL109W

  • Mass spectrometry to confirm protein identity and post-translational modifications

These methodologies complement each other and should be used in combination to ensure accurate identification and characterization of recombinant strains.

What genetic manipulation strategies are optimal for studying YNL109W function?

Several methodological approaches can be employed to study YNL109W function through genetic manipulation:

Gene Deletion (Knockout) Strategy:

  • PCR-based gene deletion method using the kanMX cassette (conferring G418 resistance)

  • Design primers with 40-45bp homology to sequences flanking the YNL109W gene

  • Amplify the kanMX cassette from a plasmid (e.g., pRED231) or yeast deletion collection strain

  • Transform the PCR product into yeast cells for homologous recombination

  • Select transformants on media containing G418

  • Verify gene deletion by PCR using primers that bind to genomic regions outside the deleted gene

Reciprocal Hemizygosity Analysis (RHA):
This approach is particularly useful for examining allelic variation effects:

  • Create hemizygous strains (containing only one copy of YNL109W) in different genetic backgrounds

  • Cross these strains to generate hybrids with different allelic combinations

  • Phenotype the resulting strains to identify allele-specific effects

Table 1: Comparison of Genetic Manipulation Approaches for YNL109W Study

ApproachAdvantagesLimitationsVerification Method
Gene DeletionComplete loss of functionLethal if essentialVerification PCR
Conditional ExpressionTemporal controlLeaky expressionWestern blot, qPCR
Point MutationsStructure-function insightsLabor-intensiveSequencing
RHAAllelic variation analysisComplex crosses requiredMating type PCR
Fluorescent TaggingLocalization studiesTag may affect functionFluorescence microscopy

The optimal choice depends on the specific research question, with gene deletion providing information about loss of function phenotypes and RHA offering insights into allelic variation effects on phenotype.

How can I design experiments to investigate YNL109W's role in dendritic cell activation and immune response?

To investigate YNL109W's potential role in dendritic cell activation and immune response, a systematic experimental approach is required:

Step 1: Recombinant Yeast Preparation

  • Generate S. cerevisiae strains expressing native or modified forms of YNL109W

  • Create control strains with empty vectors (YVEC) and strains expressing known immunostimulatory proteins

  • Verify protein expression via Western blot and quantify expression levels

Step 2: Dendritic Cell (DC) Activation Assays

  • Isolate dendritic cells from murine bone marrow or human peripheral blood

  • Expose DCs to recombinant yeast at different yeast-to-DC ratios (e.g., 10:1, 40:1, 100:1)

  • Measure upregulation of co-stimulatory molecules (CD80, CD86, CD40), adhesion molecules (CD54), and MHC class II molecules via flow cytometry

  • Assess cytokine production, particularly IL-12, using ELISA

Step 3: T Cell Stimulation Assays

  • Co-culture yeast-stimulated DCs with T cells

  • Measure T cell proliferation, cytokine production, and effector function

  • Compare responses between YNL109W-expressing yeast and control strains

Data Analysis Considerations:

  • Include appropriate statistical comparisons (e.g., ANOVA with post-hoc tests)

  • Control for multiple testing using Bonferroni or similar corrections

  • Perform dose-response analyses to determine optimal yeast-to-DC ratios

This experimental design leverages the known ability of recombinant yeast to activate dendritic cells and stimulate immune responses, as demonstrated in previous research . The design systematically tests whether YNL109W specifically contributes to these immunostimulatory properties.

What quality control measures should be implemented when working with recombinant YNL109W protein?

Rigorous quality control is essential when working with recombinant membrane proteins like YNL109W. A comprehensive QC protocol should include:

1. Purity Assessment:

  • SDS-PAGE with Coomassie or silver staining (target: ≥85% purity)

  • Densitometry analysis to quantify purity percentage

  • Western blot using antibodies against YNL109W or fusion tags

2. Identity Confirmation:

  • Mass spectrometry (MS/MS) analysis to confirm protein sequence

  • N-terminal sequencing for the first 5-10 amino acids

  • Immunological detection using specific antibodies

3. Structural Integrity:

  • Circular dichroism (CD) spectroscopy to assess secondary structure

  • Fluorescence spectroscopy to evaluate tertiary structure

  • Size exclusion chromatography to detect aggregation

4. Functional Validation:

  • Binding assays with known interaction partners

  • Activity assays if enzymatic function is known or predicted

  • Reconstitution into liposomes to verify membrane integration

5. Storage Stability Testing:

  • Aliquot the protein and test stability after storage at different temperatures

  • Avoid repeated freeze-thaw cycles as they can compromise protein integrity

  • For working stocks, limit storage at 4°C to one week maximum

Batch-to-Batch Consistency Checks:
Each new batch should be compared to previous batches using a subset of the above tests to ensure consistent quality for experimental reproducibility.

How can YNL109W be utilized in developing whole-cell recombinant yeast vaccine platforms?

YNL109W can be strategically incorporated into whole-cell recombinant yeast vaccine platforms, leveraging the unique immunostimulatory properties of yeast cells:

Methodological Framework:

  • Antigen Engineering Strategies:

    • Express YNL109W alone or fused to known immunogenic epitopes

    • Create chimeric constructs where YNL109W serves as a carrier for heterologous antigens

    • Optimize codon usage for high-level expression in S. cerevisiae

  • Immune Activation Assessment:

    • Measure dendritic cell maturation by quantifying surface markers:

      • Co-stimulatory molecules (CD80, CD86, CD40)

      • Adhesion molecules (CD54)

      • MHC class II expression

    • Assess cytokine production (particularly IL-12) by DCs exposed to recombinant yeast

    • The typical fold increase in surface marker expression based on previous studies is shown in this table:

    Table 2: Fold Increase in DC Surface Marker Expression Following Yeast Exposure

    Surface MarkerFold IncreaseSignificance for Immunity
    CD805-7×T cell co-stimulation
    CD864-6×T cell activation
    CD403-5×DC-T cell cross-talk
    CD547-9×Cell adhesion
    MHC II2-3×Antigen presentation

    Data derived from similar studies with recombinant yeast

  • T Cell Response Characterization:

    • Analyze both CD4+ and CD8+ T cell activation

    • Measure antigen-specific T cell proliferation

    • Quantify cytokine production patterns (Th1/Th2/Th17)

    • Assess cytotoxic T lymphocyte (CTL) activity using relevant target cells

  • In Vivo Vaccine Efficacy Studies:

    • Immunization protocols with optimized dosing and schedule

    • Challenge studies to assess protective immunity

    • Correlation of immune parameters with protection

The advantage of this approach lies in yeast's natural ability to be efficiently internalized by dendritic cells, delivering antigens into both MHC class I and II pathways simultaneously . This facilitates comprehensive immune activation without requiring additional adjuvants, as yeast cells possess inherent adjuvant-like properties .

What approaches can resolve contradictory data when studying YNL109W function across different Saccharomyces cerevisiae strains?

When faced with contradictory results regarding YNL109W function across different S. cerevisiae strains, a systematic approach is required to identify the sources of variation and reconcile the conflicting data:

Methodological Resolution Strategy:

  • Genetic Background Analysis:

    • Perform whole-genome sequencing of contradictory strains

    • Identify genetic variations that might influence YNL109W function

    • Conduct Quantitative Trait Locus (QTL) analysis to map genetic modifiers

    • Create genetic maps to visualize the distribution of variant loci

  • Reciprocal Hemizygosity Analysis (RHA):

    • Generate hemizygous strains in different genetic backgrounds

    • Cross strains to analyze the contribution of specific alleles to observed phenotypes

    • Create a systematic RHA matrix crossing multiple parental strains

    • This approach can identify strain-specific genetic interactions affecting YNL109W function

  • Environmental Parameter Standardization:

    • Systematically test different growth conditions (temperature, media, pH)

    • Identify condition-dependent phenotypes

    • Standardize experimental conditions across laboratories

    • Implement a PHENotyping On Solid media (PHENOS) platform for consistent analysis

  • Statistical Reconciliation Approaches:

    • Meta-analysis of all available data sets

    • Bayesian modeling to incorporate strain variation as a parameter

    • Hierarchical clustering to identify strain-specific patterns

    • Principal component analysis to determine major sources of variation

  • Technical Validation:

    • Implement standardized verification PCR protocols

    • Conduct mating type assessment by PCR to ensure genetic background consistency

    • Use complementation assays to confirm phenotype specificity

This comprehensive approach acknowledges that YNL109W function may be context-dependent, influenced by both genetic background and environmental conditions, as is common for many yeast genes involved in complex traits .

How can computational modeling be integrated with experimental data to predict YNL109W structure-function relationships?

Integrating computational modeling with experimental data provides a powerful approach to predict structure-function relationships for YNL109W:

Integrated Computational-Experimental Pipeline:

  • Sequence-Based Analysis:

    • Multiple sequence alignment with homologs across species

    • Identification of conserved domains and motifs

    • Transmembrane topology prediction using algorithms like TMHMM, Phobius

    • Hydrophobicity analysis to identify membrane-spanning regions

    • Secondary structure prediction (α-helices, β-sheets)

  • 3D Structure Prediction:

    • Homology modeling based on related membrane proteins

    • Ab initio modeling for unique regions

    • Molecular dynamics simulations to refine models

    • Integration of experimental constraints from:

      • Limited proteolysis data

      • Cross-linking experiments

      • Epitope mapping

  • Functional Site Prediction:

    • Identification of potential binding pockets

    • Prediction of post-translational modification sites

    • Conservation analysis to highlight functionally important residues

    • Electrostatic surface mapping

  • Experimental Validation Framework:

    • Site-directed mutagenesis of predicted functional residues

    • Expression of mutant proteins using cell-free systems

    • Functional assays based on predicted activities

    • Structural validation using techniques such as:

      • Limited proteolysis

      • Circular dichroism spectroscopy

      • Fluorescence spectroscopy

  • Iterative Refinement:

    • Update computational models based on experimental results

    • Design new experiments based on refined models

    • Implement machine learning approaches to improve predictions

    • Develop a quantitative scoring system to evaluate model quality

This integrated approach leverages the complementary strengths of computational prediction and experimental validation, creating a robust framework for elucidating YNL109W's structure-function relationships despite its current uncharacterized status.

What statistical frameworks are most appropriate for analyzing phenotypic changes in YNL109W deletion or mutation studies?

Statistical Analysis Methodology:

  • Experimental Design Considerations:

    • Implement factorial designs to test multiple conditions simultaneously

    • Include biological replicates (n≥3) to account for biological variability

    • Use technical replicates to assess measurement precision

    • Include appropriate controls (wild-type, complemented mutants, empty vectors)

  • Growth Phenotype Analysis:

    • Growth curve fitting using appropriate models (logistic, Gompertz, etc.)

    • Extract parameters: lag phase, doubling time, maximum growth rate

    • Compare parameters using:

      • Two-sample t-tests for single parameter comparisons

      • ANOVA with post-hoc tests for multiple conditions

      • Mixed-effects models for time-series data

  • Complex Phenotype Analysis:

    • Principal Component Analysis (PCA) for multidimensional phenotype data

    • Hierarchical clustering to identify phenotypic patterns

    • Quantitative Trait Locus (QTL) analysis for linking phenotypes to genetic loci

    • Time-series analysis for dynamic phenotypes

  • Advanced Statistical Approaches:

    • Bayesian inference to incorporate prior knowledge

    • Machine learning classification of phenotypes

    • Network analysis for identifying genetic interactions

    • Meta-analysis when combining data from multiple studies

  • Visualization and Reporting:

    • Create comprehensive visualization of phenotypic data

    • Report effect sizes along with p-values

    • Use appropriate multiple testing corrections

    • Provide detailed methods for reproducibility

Table 3: Statistical Test Selection Based on Experimental Design

Data TypeStatistical TestAssumptionsAppropriate Application
Single phenotype, two strainst-testNormality, equal varianceComparing wild-type vs. ΔynL109W
Single phenotype, multiple strainsANOVA + post-hocNormality, equal varianceComparing multiple YNL109W mutants
Growth curvesRepeated measures ANOVASphericityTime course experiments
Non-normal dataMann-Whitney, Kruskal-WallisNoneSkewed phenotypic distributions
Genetic mappingQTL analysisLinkage disequilibriumIdentifying genetic modifiers

This framework ensures rigorous statistical analysis of phenotypic changes, distinguishing true biological effects from experimental noise and providing quantitative measures of YNL109W's functional impact.

How can differential gene expression analysis be optimized to identify pathways affected by YNL109W deletion or overexpression?

Optimizing differential gene expression analysis to identify pathways affected by YNL109W manipulation requires a comprehensive methodological approach:

Optimized Gene Expression Analysis Pipeline:

  • Experimental Design Optimization:

    • Include multiple time points to capture dynamic responses

    • Test multiple environmental conditions to identify condition-dependent effects

    • Compare deletion, overexpression, and point mutants

    • Include biological replicates (minimum n=3, preferably n≥5)

  • RNA Sample Preparation Considerations:

    • Standardize cell harvesting procedures to minimize stress responses

    • Implement RNA extraction methods optimized for yeast

    • Assess RNA quality using RNA integrity number (RIN) scores

    • Include spike-in controls for normalization

  • Sequencing Strategy:

    • Select appropriate sequencing depth (30-50 million reads per sample)

    • Use strand-specific library preparation

    • Consider paired-end sequencing for improved transcript assembly

    • Include technical replicates to assess sequencing variability

  • Bioinformatic Analysis Framework:

    • Quality control: Adapter trimming, quality filtering

    • Alignment to reference genome using STAR or HISAT2

    • Quantification using featureCounts or HTSeq

    • Differential expression analysis using:

      • DESeq2 (recommended for datasets with biological replicates)

      • EdgeR (appropriate for multi-factor designs)

      • Limma-voom (robust for various experimental designs)

  • Pathway Analysis Integration:

    • Gene Ontology (GO) enrichment analysis

    • Kyoto Encyclopedia of Genes and Genomes (KEGG) pathway mapping

    • Gene Set Enrichment Analysis (GSEA)

    • Network analysis using protein-protein interaction databases

    • Integration with metabolomics data when available

  • Validation Strategies:

    • qRT-PCR validation of key differentially expressed genes

    • Protein-level validation using Western blotting

    • Phenotypic testing of identified pathway components

    • Genetic interaction studies with identified genes

This comprehensive approach not only identifies individual genes affected by YNL109W manipulation but also places these changes in the context of biological pathways and networks, providing mechanistic insights into YNL109W function.

What methods can detect subtle phenotypic changes in YNL109W mutants that might be missed by conventional approaches?

Detecting subtle phenotypic changes in YNL109W mutants requires specialized methodologies that offer increased sensitivity and resolution:

High-Sensitivity Phenotyping Methodology:

  • High-Resolution Growth Analysis:

    • Continuous optical density measurements (readings every 5-15 minutes)

    • Microfluidic single-cell growth monitoring

    • Colony size distribution analysis on solid media using the PHENOS platform

    • Competitive growth assays with fluorescently labeled strains

  • Stress Response Profiling:

    • Systematic testing across multiple stressors at sub-inhibitory concentrations

    • Chemical genomics with diverse compound libraries

    • Heat shock response kinetics

    • Oxidative stress sensitivity measurements

    • Combinations of stressors to reveal synthetic phenotypes

  • Subcellular Morphology Analysis:

    • High-content imaging with fluorescent markers for organelles

    • Automated image analysis for quantitative morphometrics

    • Time-lapse microscopy to capture dynamic processes

    • Super-resolution microscopy for fine structural details

    • Electron microscopy for ultrastructural analysis

  • Metabolomic and Lipidomic Profiling:

    • Targeted and untargeted metabolomics

    • Membrane lipid composition analysis

    • Flux analysis using isotope-labeled precursors

    • Integration with transcriptomic data for pathway analysis

  • Single-Cell Heterogeneity Assessment:

    • Flow cytometry with fluorescent reporters

    • Single-cell RNA sequencing

    • Time-lapse microfluidics to track lineages

    • Noise measurements in gene expression

  • Genetic Interaction Mapping:

    • Synthetic genetic array (SGA) analysis

    • Quantitative analysis of genetic interactions

    • Chemical-genetic interaction profiling

    • Reciprocal hemizygosity analysis across diverse genetic backgrounds

This multi-dimensional phenotyping approach can reveal subtle functional impacts of YNL109W mutations that might be missed by conventional methods, providing a comprehensive understanding of this protein's role in cellular processes.

What are common challenges in expressing and purifying recombinant YNL109W, and how can they be addressed?

Expression and purification of membrane proteins like YNL109W present specific challenges that require systematic troubleshooting:

Challenge 1: Poor Expression Levels

  • Solution: Optimize codon usage for S. cerevisiae

  • Methodology: Test different promoters (constitutive vs. inducible)

  • Advanced Approach: Utilize cell-free expression systems that bypass cellular toxicity issues

  • Validation: Monitor expression using Western blotting with antibodies against tags or the protein itself

Challenge 2: Protein Misfolding and Aggregation

  • Solution: Optimize buffer conditions (pH, ionic strength, detergents)

  • Methodology: Screen multiple detergents (DDM, LDAO, Fos-choline)

  • Advanced Approach: Co-express with chaperones or utilize fusion partners that enhance solubility

  • Validation: Assess protein homogeneity using size exclusion chromatography

Challenge 3: Low Purification Yields

  • Solution: Implement multi-step purification strategies

  • Methodology: Combine affinity chromatography with ion exchange and size exclusion

  • Advanced Approach: Develop specialized affinity tags optimized for membrane proteins

  • Validation: Determine final yield and purity (≥85% as standard)

Challenge 4: Loss of Native Structure During Purification

  • Solution: Use stabilizing agents during purification

  • Methodology: Include cholesterol or specific lipids in buffers

  • Advanced Approach: Reconstitute into nanodiscs or liposomes post-purification

  • Validation: Assess structural integrity using circular dichroism or fluorescence spectroscopy

Challenge 5: Storage Instability

  • Solution: Optimize storage conditions to maintain protein integrity

  • Methodology: Store at -20°C or -80°C with glycerol as a cryoprotectant

  • Advanced Approach: Lyophilize with appropriate excipients for long-term storage

  • Validation: Test activity after storage periods to confirm stability

This systematic approach to troubleshooting ensures that recombinant YNL109W can be successfully expressed and purified for downstream structural and functional studies.

How can researchers distinguish between direct effects of YNL109W manipulation and secondary consequences?

Distinguishing direct effects of YNL109W manipulation from secondary consequences requires a multi-faceted experimental approach:

Methodological Framework:

  • Temporal Resolution Studies:

    • Implement time-course experiments with fine temporal resolution

    • Monitor changes immediately following induction or repression

    • Use systems with rapid induction kinetics (e.g., auxin-inducible degron)

    • Distinguish early (likely direct) from late (likely indirect) effects

  • Dosage-Dependent Analysis:

    • Create strains with varying levels of YNL109W expression

    • Establish dose-response relationships for observed phenotypes

    • Identify phenotypes that linearly correlate with expression level

    • Examine threshold effects indicative of indirect consequences

  • Direct Interaction Studies:

    • Perform in vitro binding assays with purified components

    • Implement proximity labeling techniques (BioID, APEX)

    • Conduct co-immunoprecipitation experiments

    • Use yeast two-hybrid or split-ubiquitin membrane yeast two-hybrid systems

  • Genetic Interaction Mapping:

    • Conduct synthetic genetic array (SGA) analysis

    • Implement quantitative epistasis analysis

    • Perform reciprocal hemizygosity analysis

    • Create genetic interaction networks to contextualize YNL109W function

  • Controlled Expression Systems:

    • Use titratable promoters to modulate expression levels

    • Implement rapid depletion systems (anchor-away, degron tags)

    • Create conditional alleles (temperature-sensitive mutations)

    • Use orthogonal regulatory systems (tetracycline-responsive elements)

  • Complementation Analysis:

    • Test ability of wild-type YNL109W to rescue mutant phenotypes

    • Examine domain-specific contributions using truncation mutants

    • Assess cross-species complementation with orthologs

    • Test point mutants affecting specific functions

This integrated approach provides multiple lines of evidence to distinguish direct effects from secondary consequences, yielding a more accurate understanding of YNL109W's primary functions in cellular processes.

What are the critical parameters to control when comparing YNL109W function across different experimental systems?

When comparing YNL109W function across different experimental systems, several critical parameters must be controlled to ensure valid comparisons:

Critical Parameters for Cross-System Comparison:

  • Genetic Background Standardization:

    • Ensure isogenic strains except for the targeted modification

    • Document strain provenance and maintenance history

    • Verify genetic background using techniques such as:

      • Mating type assessment by PCR

      • Whole-genome sequencing for key strains

      • SNP profiling for strain authentication

    • Consider the impact of mitochondrial genome variation

  • Expression System Consistency:

    • Standardize promoters and regulatory elements

    • Verify expression levels across systems using:

      • Western blotting

      • qRT-PCR

      • Flow cytometry for single-cell analysis

    • Control for protein localization differences

  • Growth Condition Normalization:

    • Standard media composition with defined components

    • Consistent temperature, pH, and aeration

    • Standardized growth phase for experiments

    • Controlled cell density at experiment initiation

    • Documentation of environmental fluctuations

  • Methodological Standardization:

    • Implement the PHENotyping On Solid media (PHENOS) platform for consistent phenotyping

    • Standardize analytical procedures and instruments

    • Develop shared protocols with precise operational definitions

    • Use common reference standards across laboratories

    • Implement blinding procedures where applicable

  • Data Analysis Harmonization:

    • Standardized data processing workflows

    • Common statistical approaches with defined parameters

    • Shared data normalization procedures

    • Consistent significance thresholds and reporting formats

Table 4: Checklist for Cross-System Experimental Validation

Parameter CategoryKey ControlsValidation MethodsDocumentation Requirements
Genetic BackgroundIsogenic strainsVerification PCR , Mating type PCR Complete strain history
Expression SystemConsistent promotersWestern blot, qPCRExpression level quantification
Growth ConditionsStandardized mediaGrowth curvesDetailed methods section
Methodological ApproachShared protocolsPHENOS platform Protocol repository link
Data AnalysisCommon workflowsStatistical validationRaw data availability

Controlling these parameters ensures that observed differences in YNL109W function truly reflect biological variations rather than methodological inconsistencies, facilitating valid cross-system comparisons.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.