Recombinant Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W) is a protein that, as the name suggests, is derived from the yeast Saccharomyces cerevisiae . It is tagged with histidine at the N-terminal and expressed in E. coli . YNL228W is a protein that has been identified but not yet fully characterized in terms of its function . Proteins like YNL228W, are identified through genomic and proteomic studies, but their specific roles in cellular processes remain unknown .

Table 1: YNL228W Recombinant Protein Information

CategoryDescription
Cat.No.RFL5771SF
Product OverviewRecombinant Full Length Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W) Protein (P53862) (24-258aa), fused to N-terminal His tag, was expressed in E. coli .
Other NamesPutative uncharacterized membrane protein YNL228W
HostE. coli, Yeast, Baculovirus, or Mammalian Cell
PurityGreater or equal to 85% purity as determined by SDS-PAGE
Expression Region24-258
Sequence InfoFull length protein

Role in Saccharomyces cerevisiae

The Saccharomyces cerevisiae genome has been fully sequenced, and it serves as a reference for the Saccharomyces Genome Database . Despite this, a number of ORFs (Open Reading Frames) like YNL228W remain uncharacterized . Identifying the functions of these proteins is vital for a complete understanding of yeast biology and its applications in biotechnology .

Importance of Membrane Composition in Saccharomyces cerevisiae

The plasma membrane of S. cerevisiae is mainly composed of glycerophospholipids (around 70%), sphingolipids (approximately 15%), and sterols (roughly 15%) . The manipulation of membrane composition can significantly impact the yeast's fitness under industrial conditions, highlighting the importance of understanding and engineering the S. cerevisiae membrane .

Research Applications

Recombinant YNL228W protein is used in various research applications, including:

  • ELISA (Enzyme-Linked Immunosorbent Assay) ELISA Recombinant Saccharomyces cerevisiae putative uncharacterized membrane protein YNL228W (YNL228W) is used in ELISA .

  • Antibody Production YNL228W is used to generate antibodies for research purposes .

  • Protein-Protein Interaction Studies Putative uncharacterized membrane proteins are used to study protein-protein interactions .

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. To prioritize a specific tag, please indicate your requirements; we will endeavor to fulfill them.
Synonyms
YNL228W; N1249; putative uncharacterized membrane protein YNL228W
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
24-258
Protein Length
Full Length of Mature Protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
YNL228W
Target Protein Sequence
CPAIFTWLNSLFRLSNDSPHVVHTSIAEVGDIEDGRVDKDGVLFVDLEFFLGCLPFFFFA LVDQSSSSSVCKPLSPSDAKRSSNSLLRLSLVSSNDSDSSVSVSTFAFFFFFLFFLFFVF TCTFSSELTSSTSISISMLRLSSSLSSSEDDSASFLSISASSACNACRSISSFSLTLSSA ESNFSRSERLSNPSVMFSSSISFRISSIFFLCSLVFMWFFNCFSDLNVLLQIKHS
Uniprot No.

Target Background

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is YNL228W and how is it classified in the yeast proteome?

YNL228W is a putative uncharacterized membrane protein in Saccharomyces cerevisiae that belongs to the class of integral membrane proteins, which make up approximately 30% of the eukaryotic proteome. Like other membrane proteins, YNL228W is likely essential for cellular functions such as intracellular trafficking, cell signaling, or transport of molecules across the lipid bilayer. The protein is expected to contain one or more hydrophobic segments that must be correctly inserted into the lipid bilayer for proper folding and function .

What expression systems are suitable for studying YNL228W?

For studying YNL228W, researchers typically employ constitutive promoter systems in S. cerevisiae, similar to those used for other membrane proteins. A recommended approach is using the GAP (Glyceraldehyde-3-phosphate dehydrogenase) promoter for constitutive expression, as demonstrated in studies with other recombinant proteins in yeast. This system allows for stable expression and facilitates downstream analyses of protein function and interactions .

How can I confirm successful expression of recombinant YNL228W?

To confirm successful expression of recombinant YNL228W, employ Western blot analysis using antibodies against a fusion tag (such as GFP) if the native protein lacks well-characterized antibodies. Extract whole cell lysate from transformed yeast cells, resolve proteins on 10% SDS-PAGE, transfer to PVDF membrane, and detect using appropriate antibodies. Image analysis software like ImageJ can be used to quantify band intensities for comparative studies. Always include Ponceau S staining of the blot to verify equal protein loading and transfer quality .

What structural and functional approaches are most effective for characterizing YNL228W?

For comprehensive characterization of YNL228W, a multi-faceted approach combining structural and functional strategies is recommended. This should include:

  • In vitro reconstitution in model membrane systems to study protein behavior in a lipid environment

  • Biochemical assays to evaluate potential enzymatic activities or binding properties

  • Cell-based functional assays to assess physiological roles

  • Cryo-electron microscopy (cryo-EM) for structural determination, particularly valuable for membrane proteins that are often difficult to crystallize

These approaches have proven successful for characterizing other membrane proteins in the Sec61 channel family and related complexes involved in membrane protein biogenesis .

How can I determine if YNL228W interacts with the Sec61 translocon during membrane insertion?

To investigate potential interactions between YNL228W and the Sec61 translocon, researchers should consider implementing the following methodological approach:

  • Co-immunoprecipitation studies using tagged versions of YNL228W and Sec61 components

  • Proximity labeling techniques such as BioID or APEX to identify proteins in close spatial proximity during membrane insertion

  • Genetic interaction studies using conditional mutants of Sec61 components to observe effects on YNL228W localization and function

  • In vitro translation and membrane insertion assays using purified components to directly assess Sec61-dependent insertion

These approaches would help determine whether YNL228W follows the co-translational insertion pathway through the universally conserved Sec61 channel, which is the predominant route for most membrane proteins in the ER .

What is the optimal strategy for creating YNL228W deletion or overexpression strains?

For creating YNL228W deletion strains, implement a gene replacement strategy using homologous recombination. Specifically:

  • Design PCR primers with 40-50bp homology to sequences flanking the YNL228W open reading frame

  • Amplify a selection marker cassette (e.g., kanMX4 for G418 resistance)

  • Transform the PCR product into S. cerevisiae (preferably BY4741 or related laboratory strains)

  • Select transformants on appropriate selective media

  • Confirm deletion by PCR verification using primers outside the targeted region

For overexpression strains, clone the YNL228W open reading frame into an expression vector under a strong constitutive promoter (GAP) or inducible promoter (GAL1). Integrate the construct at a neutral locus (e.g., HIS3) by linearizing the plasmid within the marker gene and transforming into appropriate yeast strains. Select transformants on selective media and confirm expression by Western blot analysis .

How can I create fusion proteins with YNL228W for localization and functional studies?

To create fusion proteins with YNL228W for localization and functional studies, follow this two-step cloning procedure:

  • PCR amplify the YNL228W open reading frame using primers containing appropriate restriction sites (e.g., EcoRI and KpnI)

  • Digest both the PCR product and a plasmid containing the desired tag (e.g., GFP) with the same restriction enzymes

  • Perform ligation at 16°C overnight

  • Transform the ligation mixture into E. coli and select transformants on appropriate selective media

  • Verify positive clones by sequencing

  • Digest the resulting plasmid to release the YNL228W-tag cassette

  • Clone this cassette into a yeast expression vector with the desired promoter

  • Transform the final construct into S. cerevisiae and select for positive transformants

  • Verify expression of the fusion protein by Western blot using antibodies against the tag

This approach allows for visualization of protein localization using fluorescence microscopy and facilitates biochemical purification using affinity tags .

What specialized techniques are required to study YNL228W topology in the membrane?

To determine the membrane topology of YNL228W, employ a combination of complementary techniques:

  • Glycosylation mapping: Create fusion constructs with potential glycosylation sites at various positions; glycosylation will only occur on luminally exposed regions

  • Cysteine accessibility methods: Introduce cysteine residues at strategic positions and assess accessibility to membrane-impermeable sulfhydryl reagents

  • Protease protection assays: In isolated microsomes, determine which regions are protected from protease digestion

  • GFP-based reporters: Utilize the pH sensitivity of GFP variants to distinguish between cytosolic and luminal localization

  • Computational prediction: Employ membrane protein topology prediction algorithms as a guide for experimental design

These approaches collectively provide a comprehensive understanding of how YNL228W is oriented within the membrane, including the number of transmembrane segments and the orientation of N- and C-termini .

How can I identify potential interacting partners of YNL228W?

To identify proteins that interact with YNL228W, implement a multi-faceted interaction discovery approach:

  • Affinity purification coupled with mass spectrometry (AP-MS): Express epitope-tagged YNL228W, purify under native conditions, and identify co-purifying proteins by MS

  • Membrane yeast two-hybrid (MYTH) system: Specifically designed for membrane proteins, this split-ubiquitin based system detects interactions in their native membrane environment

  • Genetic interaction screens: Systematically test for synthetic lethality or other genetic interactions between YNL228W and other non-essential genes

  • Chemical crosslinking followed by MS: Capture transient interactions within the membrane environment

  • Co-localization studies: Use fluorescently tagged proteins to assess spatial proximity in vivo

The combination of these approaches provides complementary data that strengthens the confidence in identified interaction partners and helps build a functional interaction network for YNL228W .

What are the critical parameters for optimizing YNL228W expression in recombinant systems?

To optimize YNL228W expression in S. cerevisiae recombinant systems, carefully control these critical parameters:

  • Promoter selection: For constitutive expression, the GAP promoter provides strong, stable expression levels. For controlled expression, consider the GAL1 promoter for induction with galactose

  • Codon optimization: Although not typically necessary for expression within S. cerevisiae, consider codon optimization if expressing in heterologous systems

  • Growth conditions: Maintain cultures at 30°C with shaking at 250 rpm, and monitor growth by measuring OD600 at regular intervals

  • Media composition: YPD (1% yeast extract, 2% peptone, 2% dextrose) provides robust growth for general cultivation

  • Induction timing: For inducible promoters, induce during mid-log phase for optimal protein expression

  • Harvest time: For membrane proteins, earlier harvest times often yield better quality protein before aggregation can occur

Regular monitoring of expression levels by Western blot analysis is essential to determine the optimal harvest time and to ensure consistent protein production across experiments .

What purification strategy is most effective for maintaining YNL228W stability and function?

For purifying YNL228W while maintaining stability and function, implement this specialized membrane protein purification protocol:

  • Cell disruption: Use mechanical disruption methods (glass beads or pressure-based systems) at 4°C

  • Membrane fraction isolation: Separate membranes by differential centrifugation (10,000×g to remove debris, followed by 100,000×g to collect membranes)

  • Solubilization: Test a panel of detergents (DDM, LMNG, GDN) at various concentrations to optimize solubilization efficiency while maintaining protein function

  • Affinity purification: Utilize a fusion tag (His, FLAG, or Strep) for initial capture

  • Size exclusion chromatography: Remove aggregates and achieve higher purity

  • Stability assessment: Monitor protein stability by FSEC (fluorescence-coupled size exclusion chromatography) if using a fluorescent tag

  • Detergent exchange: If necessary for downstream applications, exchange harsh solubilization detergents with milder ones

Throughout the purification process, maintain strict temperature control (4°C) and include protease inhibitors to prevent degradation. For functional studies, consider reconstitution into nanodiscs or liposomes to provide a native-like lipid environment .

How should I approach conflicting results when analyzing YNL228W function?

When faced with conflicting results regarding YNL228W function, implement this systematic troubleshooting approach:

  • Validate experimental controls: Ensure positive and negative controls are functioning as expected in each experimental system

  • Assess strain backgrounds: Different yeast genetic backgrounds can significantly influence protein function; compare results across multiple strain backgrounds

  • Examine expression levels: Both under and overexpression can lead to artifacts; verify that expression levels are physiologically relevant

  • Evaluate fusion tag effects: If using tagged versions, test both N- and C-terminal tags and include untagged controls

  • Consider growth conditions: Growth phase, media composition, and stress conditions can all affect membrane protein function

  • Reconcile in vitro versus in vivo findings: Purified protein studies may not reflect cellular context; use complementary approaches

  • Statistical validation: Apply appropriate statistical tests to determine if differences are significant

Document all variables systematically and consider developing a standardized protocol that can be shared across research groups to improve reproducibility and resolve conflicting results .

What bioinformatic tools are most valuable for analyzing YNL228W evolutionary conservation and predicting function?

For comprehensive bioinformatic analysis of YNL228W, utilize these specialized tools and approaches:

  • Sequence homology searches: Use PSI-BLAST and HHpred to identify distant homologs beyond standard BLAST searches

  • Protein family classification: Determine membership in protein families using Pfam, InterPro, and PANTHER databases

  • Evolutionary conservation analysis: Apply ConSurf to map conservation onto predicted structural models

  • Membrane topology prediction: Combine results from TMHMM, TOPCONS, and Phobius for consensus topology prediction

  • Structural prediction: Use AlphaFold2 or RoseTTAFold for tertiary structure prediction, with special attention to membrane protein-specific limitations

  • Protein-protein interaction networks: Analyze existing networks from BioGRID and STRING databases

  • Gene co-expression analysis: Identify functionally related genes using datasets from SPELL or similar resources

  • Gene Ontology enrichment: Analyze GO terms associated with interaction partners to infer potential functions

Integrate results from multiple tools to develop consensus predictions and prioritize experimental validation of the most consistent functional hypotheses. This comprehensive approach reduces the limitations of any single prediction method .

How can I design experiments to determine if YNL228W is involved in membrane protein quality control?

To investigate YNL228W's potential role in membrane protein quality control, design experiments following this structured approach:

  • Create reporter substrates: Develop model misfolded membrane proteins tagged with fluorescent reporters to visualize degradation pathways

  • Analyze degradation kinetics: Measure half-life of reporter proteins in wildtype versus YNL228W deletion or overexpression strains

  • Assess stress response pathways: Monitor activation of unfolded protein response (UPR) markers like HAC1 splicing and BiP upregulation

  • Examine localization patterns: Determine if YNL228W colocalizes with known quality control machinery components

  • Perform genetic interaction studies: Test synthetic interactions with genes in known quality control pathways (ERAD, UPR, etc.)

  • Analyze physical interactions: Identify if YNL228W interacts with chaperones, E3 ligases, or other quality control factors

  • Create conditional alleles: Generate temperature-sensitive mutants to observe acute effects of YNL228W dysfunction

Collectively, these experiments would provide comprehensive evidence regarding YNL228W's potential role in membrane protein quality control systems, which are critical for cellular homeostasis .

What are the most promising approaches for studying the role of YNL228W in disease-related protein misfolding?

To investigate YNL228W's potential role in disease-related protein misfolding, implement these specialized experimental approaches:

  • Express human disease proteins: Introduce human disease-associated membrane proteins (e.g., from neurodegenerative disorders) into yeast with and without YNL228W

  • Develop aggregation assays: Measure aggregation propensity of disease proteins using biochemical fractionation and fluorescence microscopy

  • Use chemical chaperones: Test if compounds that alleviate protein misfolding show differential effects in YNL228W mutants

  • Perform high-throughput screens: Identify genetic modifiers that suppress or enhance disease protein toxicity in YNL228W backgrounds

  • Analyze proteostasis networks: Map changes in the global proteome and interactome in response to disease protein expression

  • Develop mammalian cell models: Validate yeast findings in mammalian cells by manipulating the closest human homolog of YNL228W

  • Assess organelle stress responses: Monitor effects on ER, mitochondrial, and other membrane-bound organelle stress pathways

These approaches leverage the genetic tractability of yeast while maintaining relevance to human disease mechanisms, potentially identifying new therapeutic targets for protein misfolding disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.