Recombinant Saccharomyces cerevisiae Putative uncharacterized protein APQ13 (APQ13)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
APQ13; YJL075C; J1044; Putative uncharacterized protein APQ13
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
APQ13
Target Protein Sequence
MLDYFFLLAFCDVYSTETFWYHFFLKSFINDANPPLGFFFLPKAALADFALIKLFPSSDE SPESSESDSDLESELESDTESELELESESELDSSSLLEGAFVCDFSFDLEVFSFTSGMPL ETRSDNELKEGRTFLGRS
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL075C

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is known about the genomic context of APQ13 in Saccharomyces cerevisiae?

APQ13 is classified as a putative uncharacterized protein in Saccharomyces cerevisiae, which has a well-characterized genome consisting of approximately 6000 genes organized across 16 chromosomes. The complete genome of S. cerevisiae was sequenced in 1996 and contains approximately 5570 protein-encoding genes . When studying APQ13, it's essential to analyze its genomic location, neighboring genes, and potential regulatory elements.

For uncharacterized proteins like APQ13, researchers should begin with bioinformatic analyses to identify whether it may have originated through lateral gene transfer, as several genes in S. cerevisiae have been found to be of foreign origin (either prokaryotic or eukaryotic) . For comprehensive genomic context analysis, utilize databases such as Saccharomyces Genome Database (SGD) to examine conserved domains, motifs, and potential orthologs in related species.

What expression systems are most effective for producing recombinant APQ13 protein?

For recombinant expression of S. cerevisiae proteins like APQ13, several methodological approaches can be employed:

When expressing an uncharacterized protein like APQ13, it's advisable to incorporate affinity tags (His-tag, GST, etc.) to facilitate purification and detection. Expression should be confirmed via Western blotting, and optimization of induction conditions is crucial for maximizing yield while maintaining protein functionality.

How can I validate that the putative APQ13 gene encodes a functional protein?

Validating the functionality of an uncharacterized protein like APQ13 requires multiple complementary approaches:

  • Gene knockout/deletion: Generate a Δapq13 strain using homologous recombination techniques common in S. cerevisiae genetics. Analyze the resulting phenotype under various conditions to identify potential functions.

  • Complementation assays: Reintroduce the wild-type APQ13 gene to the knockout strain to confirm that observed phenotypes are specifically due to the absence of APQ13.

  • Protein expression verification: Employ epitope tagging strategies to confirm protein expression in vivo, followed by subcellular localization studies using fluorescent protein fusions or immunofluorescence.

  • Protein interaction studies: Use techniques such as yeast two-hybrid screening or co-immunoprecipitation to identify potential binding partners, which may provide functional clues.

S. cerevisiae's amenability to genetic manipulation makes it an ideal system for these functional validation approaches .

What high-throughput approaches can be used to characterize APQ13's potential role in S. cerevisiae metabolism?

For comprehensive metabolic phenotyping of APQ13's function:

  • Metabolomic profiling: Compare metabolite profiles between wild-type and Δapq13 strains using LC-MS/MS or GC-MS. Focus particularly on intermediates related to the Ehrlich pathway and central carbon metabolism, as these are key aspects of S. cerevisiae physiology .

  • Flux analysis: Employ 13C metabolic flux analysis to quantify changes in metabolic pathway utilization when APQ13 is absent or overexpressed.

  • Growth phenotyping: Utilize Biolog phenotype microarrays or similar high-throughput growth assays to test the Δapq13 strain's ability to utilize different carbon sources, especially under conditions that trigger the Crabtree effect .

  • Transcriptomic response: Perform RNA-Seq to identify genes differentially expressed in response to APQ13 deletion, particularly focusing on conditions where S. cerevisiae shifts between fermentative and respiratory metabolism.

Experimental ApproachKey ParametersData Analysis MethodExpected Outcomes
MetabolomicsSample collection at multiple growth phasesPCA, hierarchical clusteringIdentification of affected metabolic pathways
13C-Flux AnalysisLabeling pattern of central metabolitesIsotopomer balancingQuantification of flux distributions
Phenotype ArraysGrowth on 96 different carbon sourcesGrowth curve analysisIdentification of specific metabolic defects
RNA-SeqMid-log and stationary phase samplingDESeq2 differential expressionRegulatory networks affected by APQ13

What methods are most appropriate for investigating potential APQ13 involvement in yeast stress response pathways?

Given S. cerevisiae's well-characterized stress response systems, investigating APQ13's potential role requires:

  • Stress challenge assays: Compare survival rates of wild-type and Δapq13 strains under various stressors (oxidative, osmotic, temperature, ethanol, pH) relevant to S. cerevisiae's natural and industrial environments.

  • Reporter gene assays: Construct reporter strains containing stress-responsive promoters (e.g., HSP12, CTT1, SOD1) fused to fluorescent proteins or luciferase to monitor stress response pathway activation in the presence/absence of APQ13.

  • Phosphoproteomic analysis: Identify changes in protein phosphorylation patterns following stress treatment in wild-type versus Δapq13 strains to determine if APQ13 influences stress-related signaling cascades.

  • Genetic interaction mapping: Perform synthetic genetic array (SGA) analysis with the Δapq13 strain crossed against yeast deletion collection to identify genetic interactions, particularly with known stress response genes.

These approaches leverage S. cerevisiae's "make-accumulate-consume" lifestyle and natural resilience to various environmental stressors .

How can protein structure prediction tools be applied effectively to generate testable hypotheses about APQ13 function?

For uncharacterized proteins like APQ13, computational structure prediction can guide experimental design:

  • Sequence-based analysis: Apply tools like HHpred, Phyre2, and AlphaFold2 to generate structural models based on remote homology detection. Search for conserved domains or structural motifs that might suggest function.

  • Molecular dynamics simulations: Conduct simulations of the predicted structure to identify stable conformations and potential binding pockets.

  • Virtual screening: If binding pockets are identified, perform in silico screening of metabolite libraries focused on S. cerevisiae metabolome to suggest potential ligands.

  • Structure-guided mutagenesis: Design targeted mutations based on structural predictions and test their effects on protein function in vivo.

  • Evolutionary analysis: Perform structure-based phylogenetic analysis to identify structural conservation patterns across species that might indicate functional constraints.

The rigorous computational workflow should lead to experimentally testable hypotheses about APQ13's biochemical function within the context of S. cerevisiae's 5570 protein-encoding genes .

What are the most common pitfalls when attempting to purify recombinant APQ13 protein, and how can they be addressed?

Purification of uncharacterized proteins like APQ13 presents several challenges:

  • Protein solubility: If APQ13 forms inclusion bodies in expression systems, optimization strategies include:

    • Reducing expression temperature to 16-20°C

    • Using solubility-enhancing fusion tags (SUMO, MBP, TrxA)

    • Co-expressing with S. cerevisiae chaperones (Ssa1p, Ydj1p)

    • Screening different detergents for membrane-associated proteins

  • Protein stability: If purified APQ13 shows degradation or aggregation:

    • Optimize buffer conditions (pH, ionic strength, reducing agents)

    • Include protease inhibitors during all purification steps

    • Test protein stabilizing additives (glycerol, arginine, trehalose)

    • Perform thermal shift assays to identify stabilizing conditions

  • Co-purifying contaminants: For highly specific purification:

    • Implement multi-step purification strategies (affinity chromatography followed by size exclusion)

    • Consider on-column refolding protocols if working with inclusion bodies

    • Use stringent washing conditions during affinity purification

  • Low expression levels: If APQ13 expresses poorly:

    • Test codon-optimized sequences for the expression host

    • Evaluate different promoter systems

    • Consider autoinduction media for bacterial expression

These approaches address challenges common to many S. cerevisiae proteins, especially those lacking characterized function or structure.

How can contradictory results from different functional assays for APQ13 be reconciled and interpreted?

When faced with conflicting data about APQ13 function:

  • Context-dependent function analysis:

    • Systematically vary experimental conditions (growth phase, media composition, temperature)

    • Test function under both fermentative and respiratory conditions, considering S. cerevisiae's Crabtree effect

    • Examine function in different genetic backgrounds to identify potential genetic modifiers

  • Data integration approaches:

    • Implement Bayesian statistical frameworks to weigh evidence from multiple assays

    • Develop network models incorporating protein-protein interactions and metabolic pathways

    • Apply machine learning approaches to identify patterns across seemingly contradictory datasets

  • Resolution strategies for specific contradictions:

    • For phenotype vs. biochemical activity discrepancies: Consider redundant pathways or compensatory mechanisms

    • For localization vs. function conflicts: Investigate condition-dependent relocalization

    • For in vitro vs. in vivo activity differences: Examine the role of cellular cofactors or post-translational modifications

  • Direct experimental resolution:

    • Design critical experiments specifically addressing the core contradiction

    • Create chimeric proteins or domain swaps to isolate functional regions

    • Implement condition-specific or inducible systems to control APQ13 activity

This systematic approach to contradiction resolution builds on S. cerevisiae's value as both a research model and biotechnologically important organism .

What strategies can be employed to investigate potential roles of APQ13 in the Ehrlich pathway and higher alcohol production?

The Ehrlich pathway is crucial for higher alcohol production in S. cerevisiae through amino acid catabolism . To investigate APQ13's potential role:

  • Targeted metabolite analysis:

    • Quantify pathway intermediates (α-ketoacids, aldehydes) and final products (higher alcohols) in wild-type vs. Δapq13 strains

    • Perform isotope tracer experiments using labeled amino acids to track flux through the pathway

  • Enzyme activity assays:

    • Test for direct interaction between APQ13 and known Ehrlich pathway enzymes (transaminases encoded by ARO8/9, BAT1/2; decarboxylases Pdc1p, Pdc5p, Pdc6p, Aro10p, Thi3p; alcohol dehydrogenases Adh1p-6p, Sfa1p)

    • Develop in vitro reconstitution assays to test if APQ13 affects activity of these enzymes

  • Structure-function studies:

    • Create point mutations in APQ13 based on structural predictions

    • Analyze effects on higher alcohol production profiles

    • Test for direct binding of APQ13 to pathway intermediates or cofactors

  • Transcriptional regulation analysis:

    • Examine if APQ13 influences expression of Ehrlich pathway genes

    • Perform ChIP-seq if APQ13 shows nuclear localization

Ehrlich Pathway ComponentGene(s)Assay MethodPotential APQ13 Interaction
TransaminasesARO8, ARO9, BAT1, BAT2Pull-down assays, activity measurementRegulatory or cofactor function
DecarboxylasesPDC1, PDC5, PDC6, ARO10, THI3Co-immunoprecipitation, enzyme kineticsSubstrate channeling, complex formation
Alcohol dehydrogenasesADH1-6, SFA1In vitro reconstitution, metabolic profilingProduct formation regulation

How can comparative genomics approaches be used to gain insights into the evolutionary conservation and potential function of APQ13?

Leveraging S. cerevisiae's position in fungal phylogeny:

  • Ortholog identification and analysis:

    • Perform sensitive sequence similarity searches (PSI-BLAST, HMMER) across fungal genomes

    • Analyze conservation patterns across Saccharomycetaceae and more distant fungi

    • Investigate presence/absence patterns across species with different metabolic capabilities

  • Synteny analysis:

    • Examine conservation of genomic context around APQ13 orthologs

    • Identify consistently co-occurring genes that might suggest functional relationships

  • Positive selection analysis:

    • Calculate Ka/Ks ratios across orthologs to identify regions under selection

    • Use site-specific models to pinpoint functionally important residues

  • Complementation studies:

    • Express APQ13 orthologs from other species in S. cerevisiae Δapq13 strain

    • Test for phenotypic complementation to establish functional conservation

  • Analysis of natural variants:

    • Compare APQ13 sequences across natural S. cerevisiae isolates with different physiological traits

    • Correlate sequence variations with strain-specific phenotypes

    • Examine structural implications of natural variants using homology models

These approaches may reveal whether APQ13 originated through lateral gene transfer, as has been documented for several S. cerevisiae genes .

What bioinformatic approaches can predict if APQ13 plays a role in S. cerevisiae's unique "make-accumulate-consume" lifestyle?

S. cerevisiae's distinctive "make-accumulate-consume" lifestyle is central to its ecological strategy and industrial applications . To investigate APQ13's potential involvement:

  • Co-expression network analysis:

    • Analyze public transcriptomic datasets to identify genes co-expressed with APQ13

    • Focus particularly on datasets capturing the transition between fermentative and respiratory metabolism

    • Construct weighted gene co-expression networks to identify functional modules containing APQ13

  • Promoter analysis:

    • Examine APQ13 promoter region for binding sites of transcription factors involved in glucose repression (Mig1p, Rgt1p)

    • Look for regulatory elements associated with diauxic shift or ethanol utilization

  • Protein-protein interaction prediction:

    • Use structural models to predict potential interactions with proteins involved in glucose sensing, ethanol production, or the Crabtree effect

    • Apply machine learning approaches trained on known yeast protein interactions

  • Comparative analysis across Crabtree-positive and Crabtree-negative yeasts:

    • Compare presence and sequence conservation of APQ13 between species exhibiting or lacking the Crabtree effect

    • Identify correlated genomic features that might suggest functional relationships

  • Regulatory network inference:

    • Integrate expression data, chromatin accessibility, and transcription factor binding information

    • Position APQ13 within the broader regulatory network governing carbon metabolism

This systems biology approach may reveal whether APQ13 contributes to S. cerevisiae's ability to produce and accumulate ethanol under aerobic conditions, which provides a competitive advantage by creating toxic conditions for competing microorganisms .

How might characterization of APQ13 contribute to understanding fundamental aspects of eukaryotic cell biology?

As an uncharacterized protein in S. cerevisiae, APQ13 research has potential to advance broader understanding of eukaryotic biology:

  • Model organism relevance:

    • S. cerevisiae is a premier eukaryotic model organism with nearly all biological functions being well conserved between it and higher eukaryotes

    • Novel proteins like APQ13 may represent previously unrecognized cellular components with conserved functions in higher organisms

  • Evolutionary insights:

    • Determining whether APQ13 is unique to fungi or has homologs in other kingdoms would provide evolutionary context

    • If APQ13 arose through lateral gene transfer (as observed for several S. cerevisiae genes), its characterization may reveal mechanisms of genetic innovation

  • Eukaryotic cell architecture:

    • Localization studies of APQ13 could reveal associations with specific organelles or cellular compartments

    • Interaction mapping might uncover novel protein complexes or subcellular structures

  • Cellular stress response mechanisms:

    • APQ13 might participate in cellular responses to environmental stressors, potentially revealing conserved stress adaptation pathways

    • Understanding such mechanisms has implications for aging research, as stress response and longevity are intimately connected

The unicellular nature of S. cerevisiae often simplifies the study of fundamental biological processes that are conserved across eukaryotes, making APQ13 characterization potentially valuable beyond fungal biology .

What considerations should guide experimental design when investigating potential genetic interactions between APQ13 and DNA repair pathways?

When investigating potential roles of APQ13 in DNA repair pathways:

  • Hypothesis-driven genetic interaction testing:

    • Create double mutants of Δapq13 with key DNA repair pathway members (RAD50, RAD51, RAD52, etc.) based on the knowledge that these genes are essential for repair processes in S. cerevisiae

    • Assess epistatic relationships through quantitative phenotyping of single and double mutants

  • DNA damage sensitivity profiling:

    • Expose wild-type and Δapq13 strains to diverse DNA damaging agents (MMS, UV, γ-radiation, EcoRI expression) that create different types of DNA lesions

    • Compare survival curves and recovery kinetics to identify specific repair pathways potentially involving APQ13

  • Recombination assay implementation:

    • Deploy established recombination reporter systems to quantify homologous recombination rates in the presence/absence of APQ13

    • Consider both mitotic and meiotic recombination contexts

  • DNA damage checkpoint analysis:

    • Examine cell cycle progression following DNA damage in Δapq13 strains

    • Monitor checkpoint proteins (Rad9p, Rad53p) activation status by Western blotting

DNA Repair PathwayKey Genes in S. cerevisiaeExperimental ApproachPotential APQ13 Involvement Readout
Homologous RecombinationRAD50-52, MRE11, XRS2DSB repair assay, EcoRI expression survivalColony formation rates, growth inhibition
Non-Homologous End JoiningYKU70, YKU80, DNL4, NEJ1NHEJ reporter assayRepair efficiency in G1 phase
Nucleotide Excision RepairRAD1, RAD2, RAD4, RAD10UV sensitivity testsSurvival curve comparison
Base Excision RepairAPN1, APN2, OGG1Alkylation damage responseGrowth in presence of MMS
Mismatch RepairMSH2, MSH6, MLH1Mutation rate measurementFluctuation analysis results

What methodological approaches would best characterize potential APQ13 involvement in protein biosynthesis or quality control pathways?

To investigate APQ13's potential role in protein biosynthesis or quality control:

  • Ribosome profiling studies:

    • Compare translational landscapes between wild-type and Δapq13 strains

    • Analyze ribosome occupancy and translation efficiency genome-wide

    • Look for specific mRNA classes affected by APQ13 absence

  • Protein folding and quality control assessment:

    • Monitor unfolded protein response (UPR) activation using HAC1 splicing assays

    • Test sensitivity to protein folding stressors (tunicamycin, DTT)

    • Examine protein aggregation patterns using reporter proteins

  • Co-translational processing analysis:

    • Investigate potential roles in signal peptide processing, protein modification, or translocation

    • Perform pulse-chase experiments to track nascent protein fates

    • Analyze protein maturation kinetics for secretory and membrane proteins

  • Genetic interaction mapping:

    • Screen for genetic interactions with components of:

      • Ribosome and translation factors

      • Endoplasmic reticulum quality control machinery

      • Cytosolic chaperone networks

      • Protein degradation pathways

  • Conditional depletion studies:

    • Create auxin-inducible degron (AID) tagged APQ13 for rapid protein depletion

    • Monitor immediate consequences on protein synthesis and folding

    • Perform time-course proteomics to identify primary versus secondary effects

These methodologies leverage S. cerevisiae's well-characterized translation and quality control machineries to position APQ13 within these essential cellular processes.

What integrated research approach would most effectively elucidate the comprehensive functional profile of APQ13?

A strategic research roadmap for complete APQ13 characterization:

  • Initial characterization phase:

    • Generate and phenotype Δapq13 strain under diverse conditions

    • Determine subcellular localization and expression patterns

    • Perform preliminary protein interaction studies

    • Conduct basic biochemical characterization of purified protein

  • Hypothesis development phase:

    • Integrate initial findings with bioinformatic predictions

    • Develop multiple working hypotheses about APQ13 function

    • Design critical experiments to discriminate between hypotheses

  • Comprehensive analysis phase:

    • Apply multi-omics approaches (proteomics, metabolomics, transcriptomics)

    • Perform targeted validation experiments for primary function

    • Map genetic and physical interaction networks

    • Conduct structure-function analysis through mutagenesis

  • Biological context integration phase:

    • Position APQ13 within cellular pathways and processes

    • Investigate condition-specific roles and regulation

    • Examine evolutionary conservation and divergence

    • Explore potential biotechnological applications

This systematic approach leverages S. cerevisiae's advantages as both a model organism and biotechnologically important species , while addressing the challenges inherent in studying an uncharacterized protein.

How can contradictory experimental outcomes regarding APQ13 function be reconciled through integrated data analysis approaches?

For resolving complex, seemingly contradictory data about APQ13:

  • Bayesian network modeling:

    • Construct probabilistic models incorporating uncertain or conflicting evidence

    • Update models progressively as new data becomes available

    • Quantify confidence in different functional hypotheses

  • Multi-scale integration:

    • Connect molecular-level observations (protein interactions, biochemical activity) with cellular phenotypes

    • Develop computational models that can explain how apparently contradictory observations may result from emergent system properties

  • Condition-dependent analysis:

    • Map the "functional space" of APQ13 across diverse environmental conditions

    • Create conditional regulatory network models

    • Identify specific contexts where different functions predominate

  • Advanced statistical approaches:

    • Apply machine learning to identify patterns in high-dimensional data

    • Use principal component analysis to reduce dimensionality and identify major sources of variation

    • Implement ensemble methods to integrate predictions from multiple algorithms

  • Community-based integration:

    • Develop standardized assays and reporting formats for APQ13 research

    • Create accessible databases for sharing raw experimental data

    • Implement collaborative analysis platforms for integrating diverse datasets

These approaches recognize that protein functions in S. cerevisiae are often context-dependent and integrated into complex cellular networks, which may explain apparently contradictory experimental outcomes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.