Recombinant Saccharomyces cerevisiae Putative uncharacterized protein HUR1 (HUR1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein HUR1 (HUR1)

Recombinant Saccharomyces cerevisiae Putative Uncharacterized Protein HUR1 (HUR1) is a bioengineered protein derived from the yeast gene HUR1 (UniProt ID: P45820). Originally identified in S. cerevisiae strain S288C , this protein is expressed in E. coli with an N-terminal His-tag for purification and functional studies . Despite its classification as "uncharacterized," HUR1 has been implicated in critical cellular processes, including DNA repair mechanisms .

DNA Repair Mechanisms

HUR1 deletion (specifically HUR1-A, a non-overlapping region with PMR1) reduces the efficiency of Non-Homologous End Joining (NHEJ), a key pathway for repairing double-strand breaks (DSBs) . Key findings include:

  • Plasmid Repair Assays: Reduced repair efficiency for both blunt-end and overhang DSBs .

  • Chromosomal Repair: Impaired DSB repair in chromosomal contexts .

  • Genetic Interactions: Epistatic relationships with TPK1 and NEJ1, suggesting functional overlap in NHEJ pathways .

Additional Roles

  • Homologous Recombination (HR): HUR1 may indirectly influence HR repair, though its role is less defined .

  • Protein Interactions: Associates with PMR1 (calcium-transporting ATPase), AUA1 (ammonia regulation), and WWM1 (apoptosis regulation) .

Research Applications and Experimental Utilities

Common Uses

ApplicationDescription
SDS-PAGEPurification and structural validation
Plasmid Repair AssaysAssessing NHEJ efficiency in HUR1-deficient strains
Genetic Interaction StudiesEpistatic analysis with TPK1, NEJ1, and YKU70

Experimental Considerations

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

Protein Interaction Network

Predicted Partners

ProteinFunctionInteraction Score
PMR1Calcium/Mn²⁺ transport0.970
AUA1Ammonia sensing0.713
WWM1Apoptosis regulation0.604
NAG1Cell wall biogenesis0.517

Functional Implications
HUR1’s interaction with PMR1 may link DNA repair to ion homeostasis, while associations with AUA1 and WWM1 suggest roles in stress responses .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery estimates.
Note: Our standard shipping includes blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HUR1; YGL168W; G1663; Putative uncharacterized protein HUR1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
HUR1
Target Protein Sequence
MFILVSVVNICTYIHLHMFPLISTFTSIGLGVLMKDKGKEGKTIKAQNVTYQTFEKYVES SSFFFLVHNFLNSSTMKTLLLMSNNNSISEIPSFSVLKILWKNGIYIAHI
Uniprot No.

Target Background

Gene References Into Functions
  1. Using a Homologous Recombination (HR) specific plasmid-based DSB repair assay, we observed that deletion of HUR1-A influenced the efficiency of HR repair, suggesting that HUR1 might also play additional roles in other DNA repair pathways PMID: 28987344
Database Links

KEGG: sce:YGL168W

STRING: 4932.YGL168W

Subcellular Location
Membrane; Single-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.