Recombinant Saccharomyces cerevisiae Putative uncharacterized protein IRC9 (IRC9)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
IRC9; YJL142C; J0650; Putative uncharacterized protein IRC9; Increased recombination centers protein 9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-130
Protein Length
full length protein
Species
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Target Names
IRC9
Target Protein Sequence
MTMQKASKVNMEVRTTLVTMQATTMSIILALPLVVLIASTLVLSVKGRRIHLATSPIILL LLILFKKGQQARSINFTLSKNKSLFCLTFLNYPFHFITAWCHNDILNKYEFCLFLIFLIR IVITINKVTL
Uniprot No.

Target Background

Database Links

STRING: 4932.YJL142C

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What exactly is IRC9 and why is it significant for research?

IRC9 (Increased Recombination Centers protein 9) is a putative uncharacterized protein in Saccharomyces cerevisiae (baker's yeast). It is encoded by the IRC9 gene, also designated as YJL142C in the yeast genome . The protein consists of 130 amino acids with apparent membrane-spanning regions .

IRC9 remains among the approximately 1000 uncharacterized yeast genes that persist despite extensive study of the yeast genome . The "IRC" designation suggests a potential role in recombination processes, though direct experimental evidence for this specific function remains limited . Studying IRC9 is significant because:

  • It represents an opportunity to expand our understanding of the complete yeast proteome

  • Characterizing its function could reveal new insights into fundamental cellular processes

  • S. cerevisiae serves as an important model organism with relevance to eukaryotic biology

  • Understanding IRC9 could potentially reveal conserved functions across fungal species

How does IRC9 differ from the similarly named iRC9 safety switch system?

It's crucial to distinguish between yeast IRC9 and the iRC9 safety switch system, as they represent entirely different systems that share only a similar abbreviation:

FeatureYeast IRC9iRC9 Safety Switch
Full nameIncreased Recombination Centers protein 9Rapamycin-induced caspase-9-based safety switch
OrganismSaccharomyces cerevisiaeEngineered system used in human cells
FunctionPutative uncharacterized proteinControlled apoptosis mechanism for cell therapies
Composition130 amino acid native yeast proteinFusion protein with FKBP12, FRB domain, and Δcaspase-9
ActivationUnknownActivated by rapamycin through dimerization
ApplicationBasic yeast biology researchSafety mechanism in CAR-T cell therapy

The iRC9 system is designed for therapeutic applications where "iRC9 comprises an FKBP12 (107 amino acids) followed by an FRB domain (89 amino acids) and Δcaspase-9," allowing rapamycin to induce dimerization and apoptosis of modified cells .

What expression systems are recommended for recombinant IRC9 production?

Several expression systems are suitable for recombinant IRC9 production, each with advantages and limitations:

Expression SystemAdvantagesLimitationsTag Options
E. coliRapid growth, high yields, cost-effectiveMay lack post-translational modificationsHis, GST, MBP, trxA
Yeast (S. cerevisiae)Native post-translational modifications, proper foldingSlower growth than bacteriaHis, FLAG, GST
Insect cellsComplex eukaryotic processing, suitable for membrane proteinsHigher cost, technical complexityHis, FLAG, GFP
Mammalian cellsHighest fidelity for eukaryotic proteinsMost expensive, lowest yieldsHis, FLAG, GFP

Commercial vendors have successfully expressed IRC9 in E. coli with a His-tag , suggesting this may be a suitable starting point for most research applications. For studies focusing on native function or interactions, the yeast expression system may be more appropriate to maintain relevant post-translational modifications .

What genomic approaches can be employed to study IRC9 function?

Several complementary genomic approaches can be used to investigate IRC9 function:

  • Knockout analysis: The S. cerevisiae knockout collection includes an IRC9 deletion strain that can be phenotypically characterized under various conditions . This systematic approach allows researchers to observe growth defects or other phenotypes associated with IRC9 deletion.

  • Transcriptomic profiling: Analysis of IRC9 expression across different conditions can provide functional insights. Previous studies have examined yeast transcriptome dynamics during wine fermentation, which included IRC9 expression data .

  • Genome-wide interaction screens:

    • Synthetic genetic array (SGA) analysis to identify genes that interact genetically with IRC9

    • Chemical-genetic profiling to identify conditions where IRC9 becomes essential

    • Suppressor screens to identify genes that can compensate for IRC9 loss

  • Experimental design considerations: When designing IRC9 functional studies, researchers should consider the Solomon four-group design or randomized block design to control for confounding variables and ensure robust results .

What methodological approaches help overcome challenges in studying uncharacterized proteins like IRC9?

Studying uncharacterized proteins presents unique challenges. These methodological approaches can help overcome them:

  • Integrated multi-omics approach:

    • Combine transcriptomics, proteomics, metabolomics, and interactomics data

    • Use genome-scale metabolic models like Yeast9 to predict functional roles

    • Apply machine learning to predict protein function from combined datasets

  • Condition-dependent phenotyping:

    • Test IRC9 knockout under diverse stress conditions (osmotic, oxidative, pH, etc.)

    • Examine growth in different carbon and nitrogen sources

    • Assess phenotypes across multiple growth phases

  • Protein localization and dynamics:

    • Use fluorescently tagged IRC9 to determine subcellular localization

    • Examine localization changes under different conditions

    • Monitor protein turnover rates using pulse-chase experiments

  • Computational analysis:

    • Apply homology modeling to predict structure

    • Use evolutionary conservation patterns to identify functional residues

    • Implement deep learning approaches to predict protein-protein interactions

The yeast community has developed extensive resources to study uncharacterized proteins, including the ability to construct strains with tagged versions of IRC9 for subcellular localization studies , which could be leveraged for comprehensive characterization.

How might IRC9 relate to DNA recombination processes in yeast?

While direct experimental evidence linking IRC9 to recombination processes is limited in the search results, several methodological approaches can be employed to investigate this potential function:

  • Recombination rate assays:

    • Measure spontaneous and induced recombination rates in wild-type vs. IRC9 deletion strains

    • Use reporter constructs with direct and inverted repeats to detect different types of recombination events

    • Assess sister chromatid exchange frequencies using fluorescent markers

  • DNA damage response analysis:

    • Compare survival of wild-type and IRC9 deletion strains after exposure to DNA damaging agents

    • Monitor Rad52 foci formation (a marker of recombination centers) in IRC9 mutants

    • Examine genetic interactions between IRC9 and known recombination genes

  • Mechanistic studies:

    • Test for physical interactions between IRC9 and known recombination proteins

    • Assess DNA binding capability through chromatin immunoprecipitation

    • Examine localization of IRC9 during recombination events or after DNA damage

The research on Irc20 (another member of the IRC protein family) shows it regulates homologous recombination-dependent increases in 2-μm plasmid levels , suggesting that IRC family proteins may indeed play roles in recombination processes.

What is known about IRC9 expression patterns and regulation?

Analysis of IRC9 expression patterns can provide important functional clues:

  • Transcriptional regulation:

    • IRC9 (YJL142C) showed differential expression during wine fermentation with a fold change of approximately 6.0 in cluster 6 of expression profiles

    • This expression pattern places it among genes responding to specific fermentation stresses

  • Experimental approaches to study regulation:

    • Promoter analysis to identify transcription factor binding sites

    • Reporter gene assays to quantify expression under different conditions

    • ChIP-seq to identify transcription factors that bind the IRC9 promoter

    • CRISPR-based transcriptional modulators to artificially control IRC9 expression

  • Post-transcriptional regulation:

    • Analysis of mRNA stability and translation efficiency

    • Identification of potential regulatory RNA interactions

    • Assessment of protein half-life under different conditions

How does IRC9 fit into the broader context of yeast cellular processes?

Placing IRC9 within the broader context of yeast cellular processes requires integrative approaches:

  • Network analysis:

    • Construct protein-protein interaction networks including IRC9

    • Analyze genetic interaction profiles to position IRC9 within cellular pathways

    • Apply gene ontology enrichment analysis to IRC9 interactors

  • Comparative genomics:

    • Examine IRC9 conservation across fungal species

    • Identify synteny patterns (conservation of gene order) around IRC9

    • Compare expression patterns of IRC9 orthologs in related species

  • Functional genomics:

    • Analyze IRC9 in the context of the yeast phenome data, which includes ~14,500 knockout screens

    • Identify conditions where IRC9 becomes particularly important

    • Determine if IRC9 relates to major signaling pathways like the Sch9 network, which functions as a central nutrient-responsive hub

How can researchers design experiments to determine IRC9 membrane topology?

Based on the amino acid sequence, IRC9 appears to contain hydrophobic regions consistent with membrane association . To determine membrane topology:

  • Experimental approaches:

    • Protease protection assays: Tag IRC9 at N- and C-termini with different epitopes, then determine which regions are protected from protease digestion

    • Glycosylation mapping: Introduce glycosylation sites at various positions to determine which face the endoplasmic reticulum lumen

    • Fluorescence microscopy: Use split GFP complementation to determine which regions are exposed to specific cellular compartments

    • Cysteine accessibility methods: Introduce cysteines at various positions and test their accessibility to membrane-impermeable labeling reagents

  • Computational prediction:

    • Apply transmembrane prediction algorithms (TMHMM, HMMTOP, etc.)

    • Construct hydropathy plots to identify potential membrane-spanning regions

    • Use structural modeling to predict membrane interaction surfaces

  • Comparative analysis:

    • Compare predicted topology with related proteins of known structure

    • Identify conserved residues that might indicate functional sites

What approaches can resolve discrepancies in IRC9 functional data?

When studying uncharacterized proteins like IRC9, researchers often encounter conflicting or ambiguous data. These methodological approaches can help resolve discrepancies:

  • Experimental design considerations:

    • Implement the Solomon four-group design to control for testing effects

    • Use randomized block designs to minimize experimental variation

    • Apply stratified random sampling when heterogeneous populations are involved

  • Statistical approaches:

    • Use appropriate statistical tests for time-series data when analyzing IRC9 expression patterns

    • Apply Bayesian analysis to integrate prior knowledge with new experimental data

    • Implement meta-analysis techniques to combine results from multiple studies

  • Validation strategies:

    • Confirm findings using multiple independent techniques

    • Test functionality in both in vivo and in vitro systems

    • Use CRISPR-based approaches for precise genetic manipulation

    • Complement genetic studies with biochemical assays

  • Data integration:

    • Apply network-based approaches to reconcile seemingly conflicting data

    • Use machine learning to identify patterns across diverse datasets

    • Implement systems biology modeling to test whether discrepancies can be explained by condition-specific behaviors

How can researchers develop a comprehensive experimental pipeline for IRC9 functional characterization?

A systematic approach to IRC9 characterization would include:

  • Phase 1: Basic Characterization

    • Confirm expression under native conditions

    • Determine subcellular localization

    • Establish phenotypic consequences of deletion

    • Identify conditions that alter expression

  • Phase 2: Interaction Mapping

    • Identify protein-protein interactions

    • Map genetic interactions

    • Determine DNA/RNA interactions if relevant

    • Characterize lipid interactions if membrane-associated

  • Phase 3: Biochemical Characterization

    • Purify recombinant protein

    • Assess post-translational modifications

    • Test for enzymatic activities

    • Determine structure-function relationships

  • Phase 4: Systems-Level Analysis

    • Position within metabolic networks

    • Identify regulatory relationships

    • Determine evolutionary conservation

    • Model cellular consequences of perturbation

  • Phase 5: Validation

    • Rescue deletion phenotypes with wild-type and mutant variants

    • Perform structure-guided mutagenesis

    • Validate in related species

    • Connect molecular function to cellular phenotypes

A comprehensive pipeline would utilize the extensive yeast genetic tools available, including the yeast knockout collection , GFP-tagged strains for localization , and genome-scale metabolic models like Yeast9 to integrate findings into a systems-level understanding.

Why do proteins like IRC9 remain uncharacterized despite advanced genomic technologies?

Despite powerful genomic technologies, proteins like IRC9 remain uncharacterized for several reasons:

  • Technical challenges:

    • Functional redundancy masks phenotypes in single-gene deletion studies

    • Condition-specific roles may not be apparent under standard laboratory conditions

    • Membrane proteins present unique purification and structural determination challenges

  • Resource allocation:

    • Research funding tends to focus on proteins with clear biomedical relevance

    • Proteins with strong phenotypes receive disproportionate attention

    • Limited researchers specifically focused on uncharacterized genes

  • Data interpretation difficulties:

    • Phenome-wide association studies can be difficult to interpret for subtle effects

    • Big data approaches generate hypotheses that require targeted validation

    • Multi-functional proteins can show seemingly contradictory experimental results

Approximately 1000 yeast genes remain uncharacterized, with IRC9 among them . This represents an opportunity for fundamental discoveries, as these proteins may reveal novel biological functions or regulatory mechanisms.

How might characterizing IRC9 contribute to our broader understanding of eukaryotic biology?

Thorough characterization of IRC9 could impact our understanding of eukaryotic biology in several ways:

  • Fundamental processes: If IRC9 is indeed involved in recombination, its study could reveal new mechanisms or regulatory aspects of this essential process

  • Evolutionary insights: Comparing IRC9 with potential orthologs in other fungi and eukaryotes could illuminate evolutionary conservation of function and protein structure

  • Systems biology: Positioning IRC9 within the yeast interactome would enhance our understanding of cellular network organization and robustness

  • Methodological advances: The process of characterizing IRC9 could drive development of new approaches for studying other uncharacterized proteins

  • Translational relevance: Discoveries about IRC9 function could potentially inform understanding of related processes in higher eukaryotes, including humans

The yeast S. cerevisiae continues to serve as a powerful model organism for understanding eukaryotic cell biology , making the characterization of its uncharacterized proteome, including IRC9, a valuable scientific endeavor.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.